(data stored in ACNUC7421 zone)

EMBL: CP002293.PE32

CP002293.PE32        Location/Qualifiers
FT   CDS             complement(44577..44879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0032"
FT                   /product="transcriptional regulator, AbrB family"
FT                   /note="KEGG: gwc:GWCH70_0032 transcriptional regulator,
FT                   AbrB family; TIGRFAM: transcriptional regulator, AbrB
FT                   family; PFAM: SpoVT/AbrB domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72888"
FT                   /db_xref="GOA:A0A0F6BHI7"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR040678"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHI7"
FT                   /inference="protein motif:TFAM:TIGR01439"
FT                   /protein_id="ADP72888.1"
FT                   /translation="MKSTGIVRKVDELGRVVIPIELRRTLDIAEKDALEIYVDDDRIIL
FT                   KKYKPNMTCVVTGEVSDDNFKLAGGKIILSREGAEILLKEIQEHLQQSSNNDNNK"
     MKSTGIVRKV DELGRVVIPI ELRRTLDIAE KDALEIYVDD DRIILKKYKP NMTCVVTGEV        60
     SDDNFKLAGG KIILSREGAE ILLKEIQEHL QQSSNNDNNK                             100
//

If you have problems or comments...

PBIL Back to PBIL home page