(data stored in ACNUC7421 zone)

EMBL: CP002293.PE320

CP002293.PE320       Location/Qualifiers
FT   CDS             372613..373050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0331"
FT                   /product="protein of unknown function DUF327"
FT                   /note="PFAM: protein of unknown function DUF327; KEGG:
FT                   gwc:GWCH70_3035 protein of unknown function DUF327"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73176"
FT                   /db_xref="InterPro:IPR005585"
FT                   /db_xref="InterPro:IPR024042"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIC5"
FT                   /inference="protein motif:PFAM:PF03885"
FT                   /protein_id="ADP73176.1"
FT                   /translation="MEIRKITNANMVNVSKKEAAASPSVSFAEVAAKQNEELALERFRQ
FT                   LAKEIEEQGKKLAESSSVEDLRKYKRLVKKLLDDAVQNGLRLSEQHGFNWSGRSRLYKM
FT                   VKEVDKKLIDLTNAVLQKEKQGIDLLGTIGEIQGLIINIYT"
     MEIRKITNAN MVNVSKKEAA ASPSVSFAEV AAKQNEELAL ERFRQLAKEI EEQGKKLAES        60
     SSVEDLRKYK RLVKKLLDDA VQNGLRLSEQ HGFNWSGRSR LYKMVKEVDK KLIDLTNAVL       120
     QKEKQGIDLL GTIGEIQGLI INIYT                                             145
//

If you have problems or comments...

PBIL Back to PBIL home page