(data stored in SCRATCH zone)

EMBL: CP002293.PE321

CP002293.PE321       Location/Qualifiers
FT   CDS             373104..373517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0332"
FT                   /product="Flagellar operon protein YvyF"
FT                   /note="TIGRFAM: Flagellar operon protein YvyF; KEGG:
FT                   afl:Aflv_2587 membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73177"
FT                   /db_xref="InterPro:IPR022258"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIC6"
FT                   /inference="protein motif:TFAM:TIGR03826"
FT                   /protein_id="ADP73177.1"
FT                   /translation="MNLANCPNCGRLFVKTSFRDICEDCYKEEEEAFEKVYHFLRKREN
FT                   RMATMAQIVDATGVKESLLIKFIQSGRLKLAQFPNLTYPCARCGALIRQGKLCENCLKD
FT                   LNQQLEELQKEERKKRRQAENIYYTKRNDENKF"
     MNLANCPNCG RLFVKTSFRD ICEDCYKEEE EAFEKVYHFL RKRENRMATM AQIVDATGVK        60
     ESLLIKFIQS GRLKLAQFPN LTYPCARCGA LIRQGKLCEN CLKDLNQQLE ELQKEERKKR       120
     RQAENIYYTK RNDENKF                                                      137
//

If you have problems or comments...

PBIL Back to PBIL home page