(data stored in ACNUC7421 zone)

EMBL: CP002293.PE322

CP002293.PE322       Location/Qualifiers
FT   CDS             373609..373872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0333"
FT                   /product="Anti-sigma-28 factor FlgM family protein"
FT                   /note="KEGG: gwc:GWCH70_3033 anti-sigma-28 factor, FlgM;
FT                   TIGRFAM: Anti-sigma-28 factor FlgM family protein; PFAM:
FT                   Anti-sigma-28 factor FlgM family protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73178"
FT                   /db_xref="GOA:A0A0F6BIC7"
FT                   /db_xref="InterPro:IPR007412"
FT                   /db_xref="InterPro:IPR031316"
FT                   /db_xref="InterPro:IPR035890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIC7"
FT                   /inference="protein motif:TFAM:TIGR03824"
FT                   /protein_id="ADP73178.1"
FT                   /translation="MRIDKFGLPGINPYKRQFDKETQVKKNAIKQDKVEISAAAKELQQ
FT                   LSQWTVEHQEKVRKLKEQVQNGTYKIDAKEIAKSVYRFYFDN"
     MRIDKFGLPG INPYKRQFDK ETQVKKNAIK QDKVEISAAA KELQQLSQWT VEHQEKVRKL        60
     KEQVQNGTYK IDAKEIAKSV YRFYFDN                                            87
//

If you have problems or comments...

PBIL Back to PBIL home page