(data stored in SCRATCH zone)

EMBL: CP002293.PE324

CP002293.PE324       Location/Qualifiers
FT   CDS             374455..376059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0335"
FT                   /product="flagellar hook-associated protein FlgK"
FT                   /note="KEGG: gwc:GWCH70_3031 flagellar hook-associated
FT                   protein FlgK; TIGRFAM: flagellar hook-associated protein
FT                   FlgK; PFAM: protein of unknown function DUF1078 domain
FT                   protein; flagellar basal body rod protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73180"
FT                   /db_xref="GOA:A0A0F6BIC9"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR002371"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIC9"
FT                   /inference="protein motif:TFAM:TIGR02492"
FT                   /protein_id="ADP73180.1"
FT                   /translation="MLSTFHGLEVAKRGMFTQQAALYVTAHNIANANTPGYSRQRVNFV
FT                   ETEPFPPASMNRPQIPGQMGTGVEAGSIQRIRDSFLDYQYRNEASKLGYWSARSEAIAK
FT                   MEDIMNEPSEFGLSKAMTQFWESLQDLSANPENEGARAVVRQRGIAVAESFNYLYTSLS
FT                   QIRDDLGQEIKTGLLEVNSILKQISELNDQIKAVEPNGYLPNDLYDKRDALVDELSKYF
FT                   QVKVETVPSGGNALDIAEGIYEISLVNQDGSTVKIVTKDGYSKLSVDPPVDPVNDPTNP
FT                   DGYVSEIRIEDALGNITTISYDKFNDLASGRIKSLIESYGYGSDPNNVKGYYPEMLADL
FT                   DKMAYSFATMFNAQHREGYDLNNSNGVDFFEMNVSDNTTGKGAAASIKVSDVIMSDLGK
FT                   IAASSNSEESGNGNNALYLSMIKDVQITNGSAALPSGSGTTVSVPITSGTVQTFYQGLI
FT                   GKIGVDGQQAERMKTNAETLATSVDNKRQSVSSVSLDEEMTNMIKFQHAYNAAARMITA
FT                   IDEMLDKIINDMGIVGR"
     MLSTFHGLEV AKRGMFTQQA ALYVTAHNIA NANTPGYSRQ RVNFVETEPF PPASMNRPQI        60
     PGQMGTGVEA GSIQRIRDSF LDYQYRNEAS KLGYWSARSE AIAKMEDIMN EPSEFGLSKA       120
     MTQFWESLQD LSANPENEGA RAVVRQRGIA VAESFNYLYT SLSQIRDDLG QEIKTGLLEV       180
     NSILKQISEL NDQIKAVEPN GYLPNDLYDK RDALVDELSK YFQVKVETVP SGGNALDIAE       240
     GIYEISLVNQ DGSTVKIVTK DGYSKLSVDP PVDPVNDPTN PDGYVSEIRI EDALGNITTI       300
     SYDKFNDLAS GRIKSLIESY GYGSDPNNVK GYYPEMLADL DKMAYSFATM FNAQHREGYD       360
     LNNSNGVDFF EMNVSDNTTG KGAAASIKVS DVIMSDLGKI AASSNSEESG NGNNALYLSM       420
     IKDVQITNGS AALPSGSGTT VSVPITSGTV QTFYQGLIGK IGVDGQQAER MKTNAETLAT       480
     SVDNKRQSVS SVSLDEEMTN MIKFQHAYNA AARMITAIDE MLDKIINDMG IVGR             534
//

If you have problems or comments...

PBIL Back to PBIL home page