(data stored in ACNUC7421 zone)

EMBL: CP002293.PE325

CP002293.PE325       Location/Qualifiers
FT   CDS             376070..376966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0336"
FT                   /product="flagellar hook-associated protein 3"
FT                   /note="KEGG: gka:GK3136 flagellar hook-associated protein
FT                   FlgL; TIGRFAM: flagellar hook-associated protein 3; PFAM:
FT                   flagellin domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73181"
FT                   /db_xref="GOA:A0A0F6BID0"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR013384"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BID0"
FT                   /inference="protein motif:TFAM:TIGR02550"
FT                   /protein_id="ADP73181.1"
FT                   /translation="MRVTQFMLANNMLRNLSNSYERLGKYQEQLVTGKKISRPSDDPVV
FT                   AMKGIAYREDLARVKQYQRNIGEVHNWIDSADDALDKVGLALQRVQELVVQASTDTATP
FT                   EDRKKIADEIDQIQKHIVDVANTKVGGKYIFNGADTKNPLFIGYPDGMGGLGLNPNANT
FT                   SDVEIEVFDGIKLDVNIDGKTLFTGIIEMLDNLKTVLNDPNSTGNTISSHLSQVEAQQD
FT                   ALLAARSELGAKQNRVEMMENRLSTQEVIATKLMSNNEDIEYEKTITDLITQESVHRAA
FT                   LSVGARIIQPTLVDFLR"
     MRVTQFMLAN NMLRNLSNSY ERLGKYQEQL VTGKKISRPS DDPVVAMKGI AYREDLARVK        60
     QYQRNIGEVH NWIDSADDAL DKVGLALQRV QELVVQASTD TATPEDRKKI ADEIDQIQKH       120
     IVDVANTKVG GKYIFNGADT KNPLFIGYPD GMGGLGLNPN ANTSDVEIEV FDGIKLDVNI       180
     DGKTLFTGII EMLDNLKTVL NDPNSTGNTI SSHLSQVEAQ QDALLAARSE LGAKQNRVEM       240
     MENRLSTQEV IATKLMSNNE DIEYEKTITD LITQESVHRA ALSVGARIIQ PTLVDFLR         298
//

If you have problems or comments...

PBIL Back to PBIL home page