(data stored in SCRATCH zone)

EMBL: CP002293.PE33

CP002293.PE33        Location/Qualifiers
FT   CDS             45312..47258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0033"
FT                   /product="methionyl-tRNA synthetase"
FT                   /note="KEGG: gwc:GWCH70_0033 methionyl-tRNA synthetase;
FT                   TIGRFAM: methionyl-tRNA synthetase; methionyl-tRNA
FT                   synthetase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72889"
FT                   /db_xref="GOA:A0A0F6BHI8"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004495"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR023457"
FT                   /db_xref="InterPro:IPR033911"
FT                   /db_xref="InterPro:IPR041872"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHI8"
FT                   /inference="protein motif:TFAM:TIGR00398"
FT                   /protein_id="ADP72889.1"
FT                   /translation="MEKKTFYLTTPIYYPSGNLHIGHAYTTVAGDAMARYKRLRGYDVM
FT                   YLTGTDEHGQKIQRKAEEKGVTPQQYVDEIVAGIQELWKKLDISYDDFIRTTQDRHKKV
FT                   VEKIFARLVEQGDIYLGEYEGWYCTPCESFYTERQLVDGNCPDCGRPVEKVKEESYFFK
FT                   MSKYVDRLLQYYEENPEFIQPESRKNEMINNFIKPGLEDLAVSRTTFDWGIKVPGDPKH
FT                   VIYVWIDALTNYITALGYGTDDDEKFRKYWPADVHLVGKEIVRFHTIYWPIMLMALDLP
FT                   LPKKVFAHGWLLMKDGKMSKSKGNVVDPVTLIDRYGLDALRYYLLREVPFGSDGVFTPE
FT                   GFVERINYDLANDLGNLLHRTVAMIEKYFDGVIPTYRGAKTPFDNDLVETAKETVKQYE
FT                   EAMEKMEFSVALATVWQLINRTNKYIDETQPWVLAKEESQKEQLASVMTHLAESLRHVA
FT                   ILLQPFLTRTPDKIFAQLGIVDESLKQWDSLYEFGLIKEGTKVAKGDPLFPRLDIEKEV
FT                   EYIKAHMQGSAPKKQAAEPQAPKADEITIDDFAKVDLRVAEVVHAEPVKNADKLLKLQL
FT                   DLGYEKRQVVSGIAQFYKPEELVGKKVICVTNLKPVKLRGELSQGMILAGEENGTLSVA
FT                   TVDKTIPNGTKIK"
     MEKKTFYLTT PIYYPSGNLH IGHAYTTVAG DAMARYKRLR GYDVMYLTGT DEHGQKIQRK        60
     AEEKGVTPQQ YVDEIVAGIQ ELWKKLDISY DDFIRTTQDR HKKVVEKIFA RLVEQGDIYL       120
     GEYEGWYCTP CESFYTERQL VDGNCPDCGR PVEKVKEESY FFKMSKYVDR LLQYYEENPE       180
     FIQPESRKNE MINNFIKPGL EDLAVSRTTF DWGIKVPGDP KHVIYVWIDA LTNYITALGY       240
     GTDDDEKFRK YWPADVHLVG KEIVRFHTIY WPIMLMALDL PLPKKVFAHG WLLMKDGKMS       300
     KSKGNVVDPV TLIDRYGLDA LRYYLLREVP FGSDGVFTPE GFVERINYDL ANDLGNLLHR       360
     TVAMIEKYFD GVIPTYRGAK TPFDNDLVET AKETVKQYEE AMEKMEFSVA LATVWQLINR       420
     TNKYIDETQP WVLAKEESQK EQLASVMTHL AESLRHVAIL LQPFLTRTPD KIFAQLGIVD       480
     ESLKQWDSLY EFGLIKEGTK VAKGDPLFPR LDIEKEVEYI KAHMQGSAPK KQAAEPQAPK       540
     ADEITIDDFA KVDLRVAEVV HAEPVKNADK LLKLQLDLGY EKRQVVSGIA QFYKPEELVG       600
     KKVICVTNLK PVKLRGELSQ GMILAGEENG TLSVATVDKT IPNGTKIK                    648
//

If you have problems or comments...

PBIL Back to PBIL home page