(data stored in ACNUC7421 zone)

EMBL: CP002293.PE330

CP002293.PE330       Location/Qualifiers
FT   CDS             complement(379672..380532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0341"
FT                   /product="LAGLIDADG DNA endonuclease"
FT                   /note="KEGG: LAGLIDADG DNA endonuclease; PFAM: LAGLIDADG
FT                   DNA endonuclease; SMART: Myb DNA-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73186"
FT                   /db_xref="GOA:A0A0F6BID5"
FT                   /db_xref="InterPro:IPR004860"
FT                   /db_xref="InterPro:IPR027434"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BID5"
FT                   /inference="protein motif:PFAM:PF03161"
FT                   /protein_id="ADP73186.1"
FT                   /translation="MQEFLQLTPIQQNILIASIIGDGEITKLYKSRRKNHSYREHFSKQ
FT                   QEEYRKWKISFFDGLLYITHKSCCVRSPSMSLFTKLYPYFYDHNGSKHLPTSLLSYCTL
FT                   PHFLSILYMDDGSLCISARVNAQKKKIYLTPHIYLYLQCYSPNELELLKQHILEVFGIT
FT                   FRLSSRTDGQGFILKTTSVKDTFRFLEMIFPITQDCLSMHYKTNWQKRLQQEELKWKNH
FT                   FPEFSIVISNSERTKPYSHEEIQRLKEMKKQGFTINEIAEALQRSYWSVVYKWKEIKKT
FT                   FSHFE"
     MQEFLQLTPI QQNILIASII GDGEITKLYK SRRKNHSYRE HFSKQQEEYR KWKISFFDGL        60
     LYITHKSCCV RSPSMSLFTK LYPYFYDHNG SKHLPTSLLS YCTLPHFLSI LYMDDGSLCI       120
     SARVNAQKKK IYLTPHIYLY LQCYSPNELE LLKQHILEVF GITFRLSSRT DGQGFILKTT       180
     SVKDTFRFLE MIFPITQDCL SMHYKTNWQK RLQQEELKWK NHFPEFSIVI SNSERTKPYS       240
     HEEIQRLKEM KKQGFTINEI AEALQRSYWS VVYKWKEIKK TFSHFE                      286
//

If you have problems or comments...

PBIL Back to PBIL home page