(data stored in ACNUC7421 zone)

EMBL: CP002293.PE332

CP002293.PE332       Location/Qualifiers
FT   CDS             381209..382993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0343"
FT                   /product="protein of unknown function DUF115"
FT                   /note="PFAM: protein of unknown function DUF115; KEGG:
FT                   lsp:Bsph_1157 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73188"
FT                   /db_xref="InterPro:IPR002826"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BID7"
FT                   /inference="protein motif:PFAM:PF01973"
FT                   /protein_id="ADP73188.1"
FT                   /translation="MDNELKEYEIVEETAKSGHRIYKVNNYYLHSKYDPIREAAKFAER
FT                   HYKKNHLHILFGVGSGYIAKALSEKMTEEEFLIIVEPIEFLADKHLEEESQLERCIIIK
FT                   GEDQELFEKIYEPFGNTFGKRVSVVCSPNYDKICSSYYHSILKIVKDHIYMQQVNINTI
FT                   KYFSKEWQKNFTLNLFYAYDDVPLKCLEHIYNVPVVVASGGPSLTKQIPLLKKVRNHIL
FT                   LISSGSTINTLLKHDIEPDFIVTIDGGINNYRHFETIELKQARIIYSLSNHEKIRERFN
FT                   RRSLVFISNIDDDLKIYAQKLLNKEIDGILGGASVANFALNIAYMISTGPVALIGQDLA
FT                   YTDNKTHAEHNKNFRKIDETYIKQRGLFYTEGYYGGQVLTDYTFFTMKHNFERLLQTFS
FT                   QPERIYNCTEGGVKLEGYQQLSFQEFCDRYVDTNKNVPMFDIDSYPHRDIQEWEEFLIR
FT                   IENEIRLHDKVQRLAEEAVLLLKRNVSDTAFDAKILKKLDKIDEQLKPIFDEGMMSLIA
FT                   QPIVLDTFNNYLEKENETEQEMYQRVYARSMDLYSRLQEAAIDSKSYFMQLKEKIKNKI
FT                   ISMDKREKDDESHLRNTR"
     MDNELKEYEI VEETAKSGHR IYKVNNYYLH SKYDPIREAA KFAERHYKKN HLHILFGVGS        60
     GYIAKALSEK MTEEEFLIIV EPIEFLADKH LEEESQLERC IIIKGEDQEL FEKIYEPFGN       120
     TFGKRVSVVC SPNYDKICSS YYHSILKIVK DHIYMQQVNI NTIKYFSKEW QKNFTLNLFY       180
     AYDDVPLKCL EHIYNVPVVV ASGGPSLTKQ IPLLKKVRNH ILLISSGSTI NTLLKHDIEP       240
     DFIVTIDGGI NNYRHFETIE LKQARIIYSL SNHEKIRERF NRRSLVFISN IDDDLKIYAQ       300
     KLLNKEIDGI LGGASVANFA LNIAYMISTG PVALIGQDLA YTDNKTHAEH NKNFRKIDET       360
     YIKQRGLFYT EGYYGGQVLT DYTFFTMKHN FERLLQTFSQ PERIYNCTEG GVKLEGYQQL       420
     SFQEFCDRYV DTNKNVPMFD IDSYPHRDIQ EWEEFLIRIE NEIRLHDKVQ RLAEEAVLLL       480
     KRNVSDTAFD AKILKKLDKI DEQLKPIFDE GMMSLIAQPI VLDTFNNYLE KENETEQEMY       540
     QRVYARSMDL YSRLQEAAID SKSYFMQLKE KIKNKIISMD KREKDDESHL RNTR             594
//

If you have problems or comments...

PBIL Back to PBIL home page