(data stored in SCRATCH zone)

EMBL: CP002293.PE333

CP002293.PE333       Location/Qualifiers
FT   CDS             382962..383324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0344"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lsp:Bsph_1158 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73189"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BID8"
FT                   /inference="similar to AA sequence:KEGG:Bsph_1158"
FT                   /protein_id="ADP73189.1"
FT                   /translation="MMNLIYETQDSFYQYIERVASGTQTIADYLREDKVGEAMQLIAQF
FT                   SEGVAWLTKVIVLMREHKYHINIDPSQINEFLLEINDGLERQDYVIVADMFEYEIKPFF
FT                   EEATKERFYQMKEDKN"
     MMNLIYETQD SFYQYIERVA SGTQTIADYL REDKVGEAMQ LIAQFSEGVA WLTKVIVLMR        60
     EHKYHINIDP SQINEFLLEI NDGLERQDYV IVADMFEYEI KPFFEEATKE RFYQMKEDKN       120
//

If you have problems or comments...

PBIL Back to PBIL home page