(data stored in SCRATCH zone)

EMBL: CP002293.PE334

CP002293.PE334       Location/Qualifiers
FT   CDS             383321..384688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0345"
FT                   /product="protein of unknown function DUF115"
FT                   /note="PFAM: protein of unknown function DUF115; KEGG:
FT                   lsp:Bsph_1159 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73190"
FT                   /db_xref="GOA:A0A0F6BID9"
FT                   /db_xref="InterPro:IPR002826"
FT                   /db_xref="InterPro:IPR003358"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BID9"
FT                   /inference="protein motif:PFAM:PF01973"
FT                   /protein_id="ADP73190.1"
FT                   /translation="MSVLDRNLALIKNKQLRERLLHPINEPIDVDIHPSKKGPPTMKLN
FT                   GHYLYSRYDPLKDAERFIDSQIDRDAHVYCLFGFGLGYHVQELLQKEPDKQIVVIEPYL
FT                   SVIRKAAENIDLSNIFLHPNVEILCFEQGQAMIRTLNELAKQQTRWIIPNAWLKAMPQS
FT                   HPLKRFLEDIKIQEMSFQRFSSLMEKNFAENLKYMDADVGKLFAKFNGQKAVLVSSGPS
FT                   LDDTVYSLKWLKNKYFILSVGSALRVLKENSIVPDAVIITDPQEFVYKQLDGMGFAQTL
FT                   IYLSTACHSAVANHKGLRIIAFQKGYPQAESYAGKKKLPLVDTGGSVATTALDILIKMG
FT                   FSEIVLLGQDLAYSKNRSHALHSTSGVEVVSNENLLSVLANDGTMVKTTTILSIYRRWF
FT                   ARKVAETKHVIFKNTAEKGAVIQGMPFVHISEIISESEHLMECNFSEKINQIINQY"
     MSVLDRNLAL IKNKQLRERL LHPINEPIDV DIHPSKKGPP TMKLNGHYLY SRYDPLKDAE        60
     RFIDSQIDRD AHVYCLFGFG LGYHVQELLQ KEPDKQIVVI EPYLSVIRKA AENIDLSNIF       120
     LHPNVEILCF EQGQAMIRTL NELAKQQTRW IIPNAWLKAM PQSHPLKRFL EDIKIQEMSF       180
     QRFSSLMEKN FAENLKYMDA DVGKLFAKFN GQKAVLVSSG PSLDDTVYSL KWLKNKYFIL       240
     SVGSALRVLK ENSIVPDAVI ITDPQEFVYK QLDGMGFAQT LIYLSTACHS AVANHKGLRI       300
     IAFQKGYPQA ESYAGKKKLP LVDTGGSVAT TALDILIKMG FSEIVLLGQD LAYSKNRSHA       360
     LHSTSGVEVV SNENLLSVLA NDGTMVKTTT ILSIYRRWFA RKVAETKHVI FKNTAEKGAV       420
     IQGMPFVHIS EIISESEHLM ECNFSEKINQ IINQY                                  455
//

If you have problems or comments...

PBIL Back to PBIL home page