(data stored in ACNUC7421 zone)

EMBL: CP002293.PE335

CP002293.PE335       Location/Qualifiers
FT   CDS             384724..385698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0346"
FT                   /product="UDP-N-acetylglucosamine 4,6-dehydratase"
FT                   /note="KEGG: bph:Bphy_3011 polysaccharide biosynthesis
FT                   protein CapD; TIGRFAM: UDP-N-acetylglucosamine
FT                   4,6-dehydratase; PFAM: polysaccharide biosynthesis protein
FT                   CapD"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73191"
FT                   /db_xref="InterPro:IPR003869"
FT                   /db_xref="InterPro:IPR020025"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIE0"
FT                   /inference="protein motif:TFAM:TIGR03589"
FT                   /protein_id="ADP73191.1"
FT                   /translation="MEFLRNQTILVTGGTGSFGKKFVKKILEYDVKKVIVFSRDELKQY
FT                   EMAQEYTDPRIRFFIGDVRDKDRLYRAFDGVDYVVHAAAMKQVPACEYNPFEAVKTNIY
FT                   GAQNVIEAAIDRGVKRVIALSTDKAAAPINLYGATKLASDKLFVAANSYVGGKETRFAV
FT                   VRYGNVVGSRGSVVPLFKKMAAEGKKLPITDERMTRFWITLDQGVQFVIDSLTRMKGGE
FT                   IFVPKIPSMKVVDLAKAIAPEAEIEIIGIRPGEKLHETMITEDDARHTVEFDNYYVITP
FT                   EFPWCPQEYVKHGRSLPEGFKYTSDTNTEWLTVEELRTLVEEV"
     MEFLRNQTIL VTGGTGSFGK KFVKKILEYD VKKVIVFSRD ELKQYEMAQE YTDPRIRFFI        60
     GDVRDKDRLY RAFDGVDYVV HAAAMKQVPA CEYNPFEAVK TNIYGAQNVI EAAIDRGVKR       120
     VIALSTDKAA APINLYGATK LASDKLFVAA NSYVGGKETR FAVVRYGNVV GSRGSVVPLF       180
     KKMAAEGKKL PITDERMTRF WITLDQGVQF VIDSLTRMKG GEIFVPKIPS MKVVDLAKAI       240
     APEAEIEIIG IRPGEKLHET MITEDDARHT VEFDNYYVIT PEFPWCPQEY VKHGRSLPEG       300
     FKYTSDTNTE WLTVEELRTL VEEV                                              324
//

If you have problems or comments...

PBIL Back to PBIL home page