(data stored in ACNUC7421 zone)

EMBL: CP002293.PE337

CP002293.PE337       Location/Qualifiers
FT   CDS             387040..387588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0349"
FT                   /product="putative acetyltransferase"
FT                   /note="KEGG: pab:PAB0773 putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73193"
FT                   /db_xref="GOA:A0A0F6BIE2"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIE2"
FT                   /inference="similar to AA sequence:KEGG:PAB0773"
FT                   /protein_id="ADP73193.1"
FT                   /translation="MKPKDVYIHNSAEVSSKASVGKGTKIWNGVQIREGAIIGENCNIG
FT                   KDVYIDKNVIIGNCVKIQNGVSIYDGVEIEDYVFLGPHMTFTNDLYPRSFNTEWRKIPT
FT                   KVRYGASIGANATVVCGVTIGKYAMVGAGAVVTQDVPDHALAVGNPAKVIGYVCKCGQP
FT                   IHYGECCKKCGEVFTGGNE"
     MKPKDVYIHN SAEVSSKASV GKGTKIWNGV QIREGAIIGE NCNIGKDVYI DKNVIIGNCV        60
     KIQNGVSIYD GVEIEDYVFL GPHMTFTNDL YPRSFNTEWR KIPTKVRYGA SIGANATVVC       120
     GVTIGKYAMV GAGAVVTQDV PDHALAVGNP AKVIGYVCKC GQPIHYGECC KKCGEVFTGG       180
     NE                                                                      182
//

If you have problems or comments...

PBIL Back to PBIL home page