(data stored in SCRATCH zone)

EMBL: CP002293.PE340

CP002293.PE340       Location/Qualifiers
FT   CDS             390167..391279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0352"
FT                   /product="Glutamine--scyllo-inositol transaminase"
FT                   /EC_number="2.6.1.50"
FT                   /note="KEGG: tth:TTC0284 pleiotropic regulatory protein;
FT                   PFAM: DegT/DnrJ/EryC1/StrS aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73196"
FT                   /db_xref="GOA:A0A0F6BIE5"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIE5"
FT                   /inference="protein motif:PRIAM:2.6.1.50"
FT                   /protein_id="ADP73196.1"
FT                   /translation="MPELIPVFDLKSEINIIYDEVLESIQEVLKSGQFIMGEQVAAFEK
FT                   EVADYLGVRHAIGVNSGTDALVIGLRSVGIGKGDEVITTPFTFFATVEAIHQIGAVPKF
FT                   VDIENCTFNIDSRKIEEAITSKTKAILPVHLFGHAAEMRTIMDLAKAYDLKVVEDTAQA
FT                   FGGEYHGQKLGTIGDVGCFSFFPTKNLGAYGDGGLIVTNDDNVAEIARKLRVHGGKNKY
FT                   NNEMFGYNSRLDEIQAAILRIKLRYVQSWNEKRRKVAKIYSERLKEISNLVLPMEKGGI
FT                   KHVYHQYTVRIVNGNRDNIYEQLLARHVQTMIYYPLPVHHLPVYRAQNIDLNLPVAESI
FT                   SKQVLSLPIWPHIEDKQVEYVCNTLQSLLS"
     MPELIPVFDL KSEINIIYDE VLESIQEVLK SGQFIMGEQV AAFEKEVADY LGVRHAIGVN        60
     SGTDALVIGL RSVGIGKGDE VITTPFTFFA TVEAIHQIGA VPKFVDIENC TFNIDSRKIE       120
     EAITSKTKAI LPVHLFGHAA EMRTIMDLAK AYDLKVVEDT AQAFGGEYHG QKLGTIGDVG       180
     CFSFFPTKNL GAYGDGGLIV TNDDNVAEIA RKLRVHGGKN KYNNEMFGYN SRLDEIQAAI       240
     LRIKLRYVQS WNEKRRKVAK IYSERLKEIS NLVLPMEKGG IKHVYHQYTV RIVNGNRDNI       300
     YEQLLARHVQ TMIYYPLPVH HLPVYRAQNI DLNLPVAESI SKQVLSLPIW PHIEDKQVEY       360
     VCNTLQSLLS                                                              370
//

If you have problems or comments...

PBIL Back to PBIL home page