(data stored in SCRATCH zone)

EMBL: CP002293.PE342

CP002293.PE342       Location/Qualifiers
FT   CDS             392058..392975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0354"
FT                   /product="protein of unknown function DUF201"
FT                   /note="KEGG: gyc:GYMC61_3212 protein of unknown function
FT                   DUF201; manually curated; PFAM: protein of unknown function
FT                   DUF201"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73198"
FT                   /db_xref="GOA:A0A0F6BIE7"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIE7"
FT                   /inference="protein motif:PFAM:PF02655"
FT                   /protein_id="ADP73198.1"
FT                   /translation="MRKASLKFQKTKGLATPPLIFGSDIDAECIGRYFVDYFWQMTEID
FT                   CLSIQKFIEYCKEHDIFAVIPTRDGDLLYFSKYADLLADNGIRVMVSQEETVQCSIDKL
FT                   KFSKKLLSLGFPSIPTFENIEDLKEIHYYVVKERFGAGSKGIGLRLTKQQALRHGLNLQ
FT                   NPIFQPYIDGKEFSIDLYVSLNRKVHGIITRTRDYVINGESHISTTQREKKLEDLCTRL
FT                   ALDMGFYGHIVIQVIKDKKGDYHIVECNSRFGGASTLSIEAGLDSFYWFFLESIGESLI
FT                   KYPFNRSKEEKRLIRFVDDLIIDV"
     MRKASLKFQK TKGLATPPLI FGSDIDAECI GRYFVDYFWQ MTEIDCLSIQ KFIEYCKEHD        60
     IFAVIPTRDG DLLYFSKYAD LLADNGIRVM VSQEETVQCS IDKLKFSKKL LSLGFPSIPT       120
     FENIEDLKEI HYYVVKERFG AGSKGIGLRL TKQQALRHGL NLQNPIFQPY IDGKEFSIDL       180
     YVSLNRKVHG IITRTRDYVI NGESHISTTQ REKKLEDLCT RLALDMGFYG HIVIQVIKDK       240
     KGDYHIVECN SRFGGASTLS IEAGLDSFYW FFLESIGESL IKYPFNRSKE EKRLIRFVDD       300
     LIIDV                                                                   305
//

If you have problems or comments...

PBIL Back to PBIL home page