(data stored in ACNUC7421 zone)

EMBL: CP002293.PE346

CP002293.PE346       Location/Qualifiers
FT   CDS             395854..396999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0358"
FT                   /product="UDP-4-keto-6-deoxy-N-acetylglucosamine
FT                   4-aminotransferase"
FT                   /EC_number="2.6.1.50"
FT                   /note="TIGRFAM: UDP-4-keto-6-deoxy-N-acetylglucosamine
FT                   4-aminotransferase; KEGG: gyc:GYMC61_3206
FT                   UDP-4-keto-6-deoxy-N-acetylglucosamine 4-aminotransferase;
FT                   PFAM: DegT/DnrJ/EryC1/StrS aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73202"
FT                   /db_xref="GOA:A0A0F6BIF1"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020026"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIF1"
FT                   /inference="protein motif:TFAM:TIGR03588"
FT                   /protein_id="ADP73202.1"
FT                   /translation="MKKRESFLSYGQQWITDEDIEAVVTVLKSPFLTQGPKIHEFERKV
FT                   ADYVGAKYAVAFSNGTAALHGACFAAGIGEGDEVITTPITFAATSNAVLYCGGKPVFAD
FT                   IDDRTYNIDPKEIRKHITPNTKAIIPVDFTGQPADMDAIMEIANEHGLVVIEDGAHSLG
FT                   AEYKGRKVGMLAHMTMFSFHPVKPVTTAEGGVIVTDSEEYYEKLKRFRSHGIIKHNLSR
FT                   DEGPWYYEMVDLGYNYRMTDLQAALGISQMDKLDCFIERRREIANMYNEAFKTMDSVIV
FT                   PMQLERTQSGWHLYVLQLKLDKLKRSRREIFESLRAENIGVHVHYIPVYWHPYYQKLGY
FT                   RKGICPKAEQWYEQALTLPIFPKMTDEDVNDVIEAVKRNVY"
     MKKRESFLSY GQQWITDEDI EAVVTVLKSP FLTQGPKIHE FERKVADYVG AKYAVAFSNG        60
     TAALHGACFA AGIGEGDEVI TTPITFAATS NAVLYCGGKP VFADIDDRTY NIDPKEIRKH       120
     ITPNTKAIIP VDFTGQPADM DAIMEIANEH GLVVIEDGAH SLGAEYKGRK VGMLAHMTMF       180
     SFHPVKPVTT AEGGVIVTDS EEYYEKLKRF RSHGIIKHNL SRDEGPWYYE MVDLGYNYRM       240
     TDLQAALGIS QMDKLDCFIE RRREIANMYN EAFKTMDSVI VPMQLERTQS GWHLYVLQLK       300
     LDKLKRSRRE IFESLRAENI GVHVHYIPVY WHPYYQKLGY RKGICPKAEQ WYEQALTLPI       360
     FPKMTDEDVN DVIEAVKRNV Y                                                 381
//

If you have problems or comments...

PBIL Back to PBIL home page