(data stored in ACNUC7421 zone)

EMBL: CP002293.PE348

CP002293.PE348       Location/Qualifiers
FT   CDS             complement(398577..399386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0360"
FT                   /product="flagellin domain protein"
FT                   /note="PFAM: flagellin domain protein; KEGG: chy:CHY_0981
FT                   flagellin"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73204"
FT                   /db_xref="GOA:A0A0F6BIF3"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR001492"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIF3"
FT                   /inference="protein motif:PFAM:PF00669"
FT                   /protein_id="ADP73204.1"
FT                   /translation="MKIQNQSMIAFSTYRYQRNVTNLTKTLEKLSSGLKIYRASDDAAG
FT                   LSISETLRAQIRGLAQSQRNMQDGLSVLKAAEEGLMNVNHLLQRIRELAVQNANDTLDA
FT                   KDRAASQKELDQLLQAIDDTAEKLEFNTKKILGENIPLTLQVGANPGQTITVDMVDTST
FT                   TSLGLNGATLLTRTDAEQLITKVDNALKKVTNDLTNVGADYEAIEHHLNNTMLKEANLT
FT                   TSESMLRDANIAREMMNYISGKIRQQGDYLLISHINRNVEETLKLLT"
     MKIQNQSMIA FSTYRYQRNV TNLTKTLEKL SSGLKIYRAS DDAAGLSISE TLRAQIRGLA        60
     QSQRNMQDGL SVLKAAEEGL MNVNHLLQRI RELAVQNAND TLDAKDRAAS QKELDQLLQA       120
     IDDTAEKLEF NTKKILGENI PLTLQVGANP GQTITVDMVD TSTTSLGLNG ATLLTRTDAE       180
     QLITKVDNAL KKVTNDLTNV GADYEAIEHH LNNTMLKEAN LTTSESMLRD ANIAREMMNY       240
     ISGKIRQQGD YLLISHINRN VEETLKLLT                                         269
//

If you have problems or comments...

PBIL Back to PBIL home page