(data stored in ACNUC7421 zone)

EMBL: CP002293.PE35

CP002293.PE35        Location/Qualifiers
FT   CDS             48260..48403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0035"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72891"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHJ0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADP72891.1"
FT                   /translation="MSTSLPFFFSDFSCIIECVYTYTFRERGIFAQEGGVLHDITQYEE
FT                   NF"
     MSTSLPFFFS DFSCIIECVY TYTFRERGIF AQEGGVLHDI TQYEENF                      47
//

If you have problems or comments...

PBIL Back to PBIL home page