(data stored in ACNUC7421 zone)

EMBL: CP002293.PE352

CP002293.PE352       Location/Qualifiers
FT   CDS             401888..402241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0364"
FT                   /product="flagellar protein"
FT                   /note="KEGG: lsp:Bsph_1173 flagellar protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73208"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIF7"
FT                   /inference="similar to AA sequence:KEGG:Bsph_1173"
FT                   /protein_id="ADP73208.1"
FT                   /translation="MDLIEQLVSCSESLLEVLQHSADERDKQVEKVEQLLAEREKIIAR
FT                   LKQGSYENLHQHPQARKIVEMEQDIQKGLRRLYEDIKMDLKRWNEKKRLQQSYENTFSY
FT                   VETYDGRFYDKRK"
     MDLIEQLVSC SESLLEVLQH SADERDKQVE KVEQLLAERE KIIARLKQGS YENLHQHPQA        60
     RKIVEMEQDI QKGLRRLYED IKMDLKRWNE KKRLQQSYEN TFSYVETYDG RFYDKRK          117
//

If you have problems or comments...

PBIL Back to PBIL home page