(data stored in ACNUC7421 zone)

EMBL: CP002293.PE355

CP002293.PE355       Location/Qualifiers
FT   CDS             join(406441..406515,406517..407545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /ribosomal_slippage
FT                   /locus_tag="GY4MC1_0369"
FT                   /product="Peptide chain release factor 2"
FT                   /note="manually curated; KEGG: gwc:GWCH70_3007 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73211"
FT                   /db_xref="GOA:A0A0F6BIG0"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004374"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIG0"
FT                   /inference="similar to AA sequence:KEGG:GWCH70_3007"
FT                   /protein_id="ADP73211.1"
FT                   /translation="MIDLIEIKQELEKMAKRLAEIRGSLDLEAKQARIRELEEQMAEPD
FT                   FWDDQKAAQTVINEANALKDLVGEFQSLEERFENLEVTYELIKEEPDEDLQQELVTEAK
FT                   RLTKDFSEFELQLLLNEPYDKNNAILELHPGAGGTESQDWASMLLRMYTRWAEKKGFKV
FT                   ETLDYLPGEEAGIKSVTLLIKGHNAYGYLKAEKGVHRLVRISPFDASGRRHTSFVSCEV
FT                   IPEMDDDIEIEIRPEEIRIDTYRSSGAGGQHVNTTDSAVRITHIPTGIVVTCQSERSQI
FT                   KNREKALNMLKAKLYQKKLEEQQAELAEIRGEQKEIGWGNQIRSYVFHPYSLVKDHRTN
FT                   VEVGNVQAVMDGEIDIFIDAYLRSKLK"
     MIDLIEIKQE LEKMAKRLAE IRGSLDLEAK QARIRELEEQ MAEPDFWDDQ KAAQTVINEA        60
     NALKDLVGEF QSLEERFENL EVTYELIKEE PDEDLQQELV TEAKRLTKDF SEFELQLLLN       120
     EPYDKNNAIL ELHPGAGGTE SQDWASMLLR MYTRWAEKKG FKVETLDYLP GEEAGIKSVT       180
     LLIKGHNAYG YLKAEKGVHR LVRISPFDAS GRRHTSFVSC EVIPEMDDDI EIEIRPEEIR       240
     IDTYRSSGAG GQHVNTTDSA VRITHIPTGI VVTCQSERSQ IKNREKALNM LKAKLYQKKL       300
     EEQQAELAEI RGEQKEIGWG NQIRSYVFHP YSLVKDHRTN VEVGNVQAVM DGEIDIFIDA       360
     YLRSKLK                                                                 367
//

If you have problems or comments...

PBIL Back to PBIL home page