(data stored in ACNUC7421 zone)

EMBL: CP002293.PE356

CP002293.PE356       Location/Qualifiers
FT   CDS             407871..408731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0370"
FT                   /product="Protein of unknown function DUF2179"
FT                   /note="PFAM: Protein of unknown function DUF2179; protein
FT                   of unknown function DUF161; KEGG: gwc:GWCH70_3006 protein
FT                   of unknown function DUF161"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73212"
FT                   /db_xref="GOA:A0A0F6BIG1"
FT                   /db_xref="InterPro:IPR003740"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR019264"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIG1"
FT                   /inference="protein motif:PFAM:PF10035"
FT                   /protein_id="ADP73212.1"
FT                   /translation="MRRKNRLLHPKTELVIEYLCILIGSAIVAVAFNLFLLPNRVASGG
FT                   VSGISTIAHAVFGWQPAYVQWALNIPLFIAGVVLLGRQFGVKTLVGTLFLPLVVYLTKD
FT                   VEPATRDPLLGSLFGGIGVGLGLGIVFRGKASTGGTDLAAQIIHKYTGLSLGMCVVLID
FT                   GLIVSTAAFVFDIEQALYALIGLYVTSKTIDLVQVGLGSSKMAMIITNEEEKVRRAILH
FT                   EIDRGVTRLSGYGGYTDHERPVLMCVVQQAEFTKLKQLVKTIDPSAFVIVMNAAEVLGE
FT                   GFKRT"
     MRRKNRLLHP KTELVIEYLC ILIGSAIVAV AFNLFLLPNR VASGGVSGIS TIAHAVFGWQ        60
     PAYVQWALNI PLFIAGVVLL GRQFGVKTLV GTLFLPLVVY LTKDVEPATR DPLLGSLFGG       120
     IGVGLGLGIV FRGKASTGGT DLAAQIIHKY TGLSLGMCVV LIDGLIVSTA AFVFDIEQAL       180
     YALIGLYVTS KTIDLVQVGL GSSKMAMIIT NEEEKVRRAI LHEIDRGVTR LSGYGGYTDH       240
     ERPVLMCVVQ QAEFTKLKQL VKTIDPSAFV IVMNAAEVLG EGFKRT                      286
//

If you have problems or comments...

PBIL Back to PBIL home page