(data stored in ACNUC7421 zone)

EMBL: CP002293.PE359

CP002293.PE359       Location/Qualifiers
FT   CDS             409991..410884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0373"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   gwc:GWCH70_3003 protein of unknown function DUF214"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73215"
FT                   /db_xref="GOA:A0A0F6BIG4"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR004513"
FT                   /db_xref="InterPro:IPR040690"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIG4"
FT                   /inference="protein motif:PFAM:PF02687"
FT                   /protein_id="ADP73215.1"
FT                   /translation="MRLNTLKRHMRESMKSLGRNGWMTFASISAVTVTLLLVGVFLVVM
FT                   FNMNHFAEKIENDVEIRVHIDVAANEQDKQALRTQIEAIPKVKEIRYSSKEQELKNLIK
FT                   SFGEEGSSFRLFEQDNPLSDVYVVKTEKPTDTIKVAKQIEKLQFVHKVNYGQGQVEKLF
FT                   STLKVARNVGIVLIIGLLFTAMFLISNTIKITIFARRREIEIMRLVGATNGFIRWPFFL
FT                   EGLWLGVIGAIFPIVSILVVYYNIYKFLEPKITVPFIELLPLNPFMWQISLILLIFGAC
FT                   IGVWGSMMSVRRFLKV"
     MRLNTLKRHM RESMKSLGRN GWMTFASISA VTVTLLLVGV FLVVMFNMNH FAEKIENDVE        60
     IRVHIDVAAN EQDKQALRTQ IEAIPKVKEI RYSSKEQELK NLIKSFGEEG SSFRLFEQDN       120
     PLSDVYVVKT EKPTDTIKVA KQIEKLQFVH KVNYGQGQVE KLFSTLKVAR NVGIVLIIGL       180
     LFTAMFLISN TIKITIFARR REIEIMRLVG ATNGFIRWPF FLEGLWLGVI GAIFPIVSIL       240
     VVYYNIYKFL EPKITVPFIE LLPLNPFMWQ ISLILLIFGA CIGVWGSMMS VRRFLKV          297
//

If you have problems or comments...

PBIL Back to PBIL home page