(data stored in ACNUC7421 zone)

EMBL: CP002293.PE36

CP002293.PE36        Location/Qualifiers
FT   CDS             48372..49574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0036"
FT                   /product="G5 domain protein"
FT                   /note="PFAM: G5 domain protein; 3D domain-containing
FT                   protein; protein of unknown function DUF348; KEGG:
FT                   gwc:GWCH70_0035 3D domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72892"
FT                   /db_xref="GOA:A0A0F6BHJ1"
FT                   /db_xref="InterPro:IPR007137"
FT                   /db_xref="InterPro:IPR010611"
FT                   /db_xref="InterPro:IPR011098"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHJ1"
FT                   /inference="protein motif:PFAM:PF07501"
FT                   /protein_id="ADP72892.1"
FT                   /translation="MILPNMKRISDSLRKNFTVTASSFIAFSATTGLAGYEIAKDDVTL
FT                   TVNGKKQEIRTHAKTVKEVLQEQNIKPRKEDHVYPSLDTPITDDLNIVWEASKKVTLIV
FT                   DGKKQEIWTTAKNVGELLNSQHITLGKHDKIAPSPNAEIKKGMEVNVEKAFPVQLNVGG
FT                   KQKQVWATSTTVADFLKQQNVKLGELDRVEPSLQEKVKEGMIVKVVKVQKVTDVVEEPI
FT                   DFAVVTRRDAQLPKGEQRVISPGEKGKALKRYEVVLENGKEVSRKLIETKLMKASKNRI
FT                   VAIGTRSTHARPVQIASRGQRHATKEFYVTATAYTAYCEGCSGTTSTGIDLRANPSAKV
FT                   IAVDPRIIPIGSKVYVEGYGYAIAGDTGSSINGYKIDVFFPKKSDAFRWGKKRVKVKII
FT                   Q"
     MILPNMKRIS DSLRKNFTVT ASSFIAFSAT TGLAGYEIAK DDVTLTVNGK KQEIRTHAKT        60
     VKEVLQEQNI KPRKEDHVYP SLDTPITDDL NIVWEASKKV TLIVDGKKQE IWTTAKNVGE       120
     LLNSQHITLG KHDKIAPSPN AEIKKGMEVN VEKAFPVQLN VGGKQKQVWA TSTTVADFLK       180
     QQNVKLGELD RVEPSLQEKV KEGMIVKVVK VQKVTDVVEE PIDFAVVTRR DAQLPKGEQR       240
     VISPGEKGKA LKRYEVVLEN GKEVSRKLIE TKLMKASKNR IVAIGTRSTH ARPVQIASRG       300
     QRHATKEFYV TATAYTAYCE GCSGTTSTGI DLRANPSAKV IAVDPRIIPI GSKVYVEGYG       360
     YAIAGDTGSS INGYKIDVFF PKKSDAFRWG KKRVKVKIIQ                             400
//

If you have problems or comments...

PBIL Back to PBIL home page