(data stored in ACNUC7421 zone)

EMBL: CP002293.PE361

CP002293.PE361       Location/Qualifiers
FT   CDS             412451..412852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0375"
FT                   /product="DoxX family protein"
FT                   /note="PFAM: DoxX family protein; KEGG: hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73217"
FT                   /db_xref="GOA:A0A0F6BIG6"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIG6"
FT                   /inference="protein motif:PFAM:PF07681"
FT                   /protein_id="ADP73217.1"
FT                   /translation="MASIGLLLIRFVFGLTFAGHGAQKLFGWFGGHGLKGTAGWMESIG
FT                   LKPGKAMAFAAGASELAGGILFAIGLWTPLAALLMVVPMIVAIAKVHGPNGYWVTQNGY
FT                   EYNLAIIAVAIGVALTGPGQYSLDAIIFG"
     MASIGLLLIR FVFGLTFAGH GAQKLFGWFG GHGLKGTAGW MESIGLKPGK AMAFAAGASE        60
     LAGGILFAIG LWTPLAALLM VVPMIVAIAK VHGPNGYWVT QNGYEYNLAI IAVAIGVALT       120
     GPGQYSLDAI IFG                                                          133
//

If you have problems or comments...

PBIL Back to PBIL home page