(data stored in ACNUC7421 zone)

EMBL: CP002293.PE363

CP002293.PE363       Location/Qualifiers
FT   CDS             413852..415294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0377"
FT                   /product="carboxyl-terminal protease"
FT                   /EC_number="3.4.21.102"
FT                   /note="SMART: peptidase S41; PDZ/DHR/GLGF domain protein;
FT                   TIGRFAM: carboxyl-terminal protease; KEGG: gwc:GWCH70_2998
FT                   carboxyl-terminal protease; PFAM: peptidase S41;
FT                   PDZ/DHR/GLGF domain protein; Peptidoglycan-binding domain 1
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73219"
FT                   /db_xref="GOA:A0A0F6BIG8"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR004447"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIG8"
FT                   /inference="protein motif:TFAM:TIGR00225"
FT                   /protein_id="ADP73219.1"
FT                   /translation="MNKKTTAMLMVLSMLIGAGGTYAGMQLAAPDGDHDVSLVASDKTL
FT                   TDNEEKELKKVEQAYELIKSRYVEKVDDDKLIQGAIQGMISTLNDPYSVYMDEKTTEQF
FT                   NESLDSSFEGIGAEVSMIDGKVTIVAPIKNSPAEKAGLKPNDQILRVNGESLEGLDLYE
FT                   AVLKIRGKKGTTVQLDVLRPGVKDVIKVKVVRDEIPIETVYDSVKTYNGKKVGYLEVTS
FT                   FSENTAQDFKKKLAKLEEDHIDGLIIDVRGNPGGYLQSVEEILKQFIPKDKPYVQIEER
FT                   NGDKQRFYSDLTAKKPYPIVVLIDKGSASASEILAGAMKEAGGYKLVGETSFGKGTVQQ
FT                   AIPMGDGSNIKLTLYKWLTPDGHWIHKKGVKPDVEVKQPDYFHASPLHIEKALSFDMNN
FT                   EQVKNAQQMLKGIGFDPGRTDGYFSKETEAAVKAFQKANKLPPTGKIDKNTADVLQAKV
FT                   MEAIRNEDNDVQLKTAMKVLFQ"
     MNKKTTAMLM VLSMLIGAGG TYAGMQLAAP DGDHDVSLVA SDKTLTDNEE KELKKVEQAY        60
     ELIKSRYVEK VDDDKLIQGA IQGMISTLND PYSVYMDEKT TEQFNESLDS SFEGIGAEVS       120
     MIDGKVTIVA PIKNSPAEKA GLKPNDQILR VNGESLEGLD LYEAVLKIRG KKGTTVQLDV       180
     LRPGVKDVIK VKVVRDEIPI ETVYDSVKTY NGKKVGYLEV TSFSENTAQD FKKKLAKLEE       240
     DHIDGLIIDV RGNPGGYLQS VEEILKQFIP KDKPYVQIEE RNGDKQRFYS DLTAKKPYPI       300
     VVLIDKGSAS ASEILAGAMK EAGGYKLVGE TSFGKGTVQQ AIPMGDGSNI KLTLYKWLTP       360
     DGHWIHKKGV KPDVEVKQPD YFHASPLHIE KALSFDMNNE QVKNAQQMLK GIGFDPGRTD       420
     GYFSKETEAA VKAFQKANKL PPTGKIDKNT ADVLQAKVME AIRNEDNDVQ LKTAMKVLFQ       480
//

If you have problems or comments...

PBIL Back to PBIL home page