(data stored in ACNUC7421 zone)

EMBL: CP002293.PE364

CP002293.PE364       Location/Qualifiers
FT   CDS             complement(415333..415731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0378"
FT                   /product="GtrA family protein"
FT                   /note="PFAM: GtrA family protein; KEGG: bmq:BMQ_3973
FT                   GtrA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73220"
FT                   /db_xref="GOA:A0A0F6BIG9"
FT                   /db_xref="InterPro:IPR007267"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIG9"
FT                   /inference="protein motif:PFAM:PF04138"
FT                   /protein_id="ADP73220.1"
FT                   /translation="MNQPFLRFLLVSIIHTAAGLSIMHLLYRLPHVPYWQATLAGIAAS
FT                   AVISYILNRTFTFQSNVSIIKSTFRFIAVMIVCYYCSYRLSTQLTDWAALTAGIISPRL
FT                   ANNAAILLGAGFYTILNYIGQKQFVFFR"
     MNQPFLRFLL VSIIHTAAGL SIMHLLYRLP HVPYWQATLA GIAASAVISY ILNRTFTFQS        60
     NVSIIKSTFR FIAVMIVCYY CSYRLSTQLT DWAALTAGII SPRLANNAAI LLGAGFYTIL       120
     NYIGQKQFVF FR                                                           132
//

If you have problems or comments...

PBIL Back to PBIL home page