(data stored in ACNUC7421 zone)

EMBL: CP002293.PE365

CP002293.PE365       Location/Qualifiers
FT   CDS             complement(415728..416720)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0379"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   gka:GK3091 glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73221"
FT                   /db_xref="GOA:A0A0F6BIH0"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIH0"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ADP73221.1"
FT                   /translation="MQKPVLTIVVPCYNEEDVLPETIKQLTNVLEHLMEEHLIAGGSKV
FT                   LFVDDGSRDRTWELIEQESEQNPLVTGIKLSRNFGHQKALLAGLETAKNDSDCVISIDA
FT                   DLQDDVSAIREFVVKYWEGYDIVYGVRRSRDADTWFKRATAQWFYRFMQKLGVHVVYNH
FT                   ADFRLMSKRALEELSRYTEVNIFLRGIVPLLGFRTTKVFYDRKERFAGQSKYPLKKMLS
FT                   FAFDGITSFSIAPIRFITFIGFLAFFLSSIAGIYALAVKLLGHAESGWTSIIISIWFIG
FT                   GLLLMGIGLIGEYIGKIYQEVKRRPRFTIEKTLRSPALPPLSKKEKVQL"
     MQKPVLTIVV PCYNEEDVLP ETIKQLTNVL EHLMEEHLIA GGSKVLFVDD GSRDRTWELI        60
     EQESEQNPLV TGIKLSRNFG HQKALLAGLE TAKNDSDCVI SIDADLQDDV SAIREFVVKY       120
     WEGYDIVYGV RRSRDADTWF KRATAQWFYR FMQKLGVHVV YNHADFRLMS KRALEELSRY       180
     TEVNIFLRGI VPLLGFRTTK VFYDRKERFA GQSKYPLKKM LSFAFDGITS FSIAPIRFIT       240
     FIGFLAFFLS SIAGIYALAV KLLGHAESGW TSIIISIWFI GGLLLMGIGL IGEYIGKIYQ       300
     EVKRRPRFTI EKTLRSPALP PLSKKEKVQL                                        330
//

If you have problems or comments...

PBIL Back to PBIL home page