(data stored in ACNUC7421 zone)

EMBL: CP002293.PE366

CP002293.PE366       Location/Qualifiers
FT   CDS             complement(416738..418414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0380"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gyc:GYMC61_3179 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73222"
FT                   /db_xref="GOA:A0A0F6BIH1"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIH1"
FT                   /inference="similar to AA sequence:KEGG:GYMC61_3179"
FT                   /protein_id="ADP73222.1"
FT                   /translation="MGMKRNERTAIGIALLLLAVYLSPLYILGEDAHIRVHDNMDSNIA
FT                   WYKVLARSGELFGPLNATIPQVINGLPRNAFGTEFSGIVWLHALFPSMVAYALSQTITR
FT                   VFAFIGMYALLKRHFLPDEESYLIRVGASLAFALTPFWPSGMLSTLGMPLALWAFLTIR
FT                   KGEATWKEWLVLVLLPFYASFVLGFFFFLAAMALLWLRDIIVQKRWNWPFFGAIALMTV
FT                   IFFAIEYRLVYSLVFGEEPTSRNEFLSSRLSFLHCVRLTFKNYLLGHTHVMTVHTFVIL
FT                   PILWITFFFAWAKRSETLEKQFIFLFVLNFVLSTWYAFWFYKGWQPLKERISLLNTFNF
FT                   ARFHFLRPMVIYLDFALALQILWKQGIRWRRVVPAALALQLLILGGFNEEIRYRLIGTP
FT                   SFKEFYAEHLFNEIKQYIGKPQSSYRVASVGLHPAIAQYNGFYTLDTYNNFYPLSYKHQ
FT                   FRKIIAKELDKSPVLQDYFDHWGNRVYLFSAELGKHYMFRKTSHKKIHHFDINTKVFKQ
FT                   MGGRYIFSSVPIMNAKEIHLRLLRTFEDSQAAWKIYVYEVE"
     MGMKRNERTA IGIALLLLAV YLSPLYILGE DAHIRVHDNM DSNIAWYKVL ARSGELFGPL        60
     NATIPQVING LPRNAFGTEF SGIVWLHALF PSMVAYALSQ TITRVFAFIG MYALLKRHFL       120
     PDEESYLIRV GASLAFALTP FWPSGMLSTL GMPLALWAFL TIRKGEATWK EWLVLVLLPF       180
     YASFVLGFFF FLAAMALLWL RDIIVQKRWN WPFFGAIALM TVIFFAIEYR LVYSLVFGEE       240
     PTSRNEFLSS RLSFLHCVRL TFKNYLLGHT HVMTVHTFVI LPILWITFFF AWAKRSETLE       300
     KQFIFLFVLN FVLSTWYAFW FYKGWQPLKE RISLLNTFNF ARFHFLRPMV IYLDFALALQ       360
     ILWKQGIRWR RVVPAALALQ LLILGGFNEE IRYRLIGTPS FKEFYAEHLF NEIKQYIGKP       420
     QSSYRVASVG LHPAIAQYNG FYTLDTYNNF YPLSYKHQFR KIIAKELDKS PVLQDYFDHW       480
     GNRVYLFSAE LGKHYMFRKT SHKKIHHFDI NTKVFKQMGG RYIFSSVPIM NAKEIHLRLL       540
     RTFEDSQAAW KIYVYEVE                                                     558
//

If you have problems or comments...

PBIL Back to PBIL home page