(data stored in ACNUC7421 zone)

EMBL: CP002293.PE368

CP002293.PE368       Location/Qualifiers
FT   CDS             419298..420485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0382"
FT                   /product="PDZ/DHR/GLGF domain protein"
FT                   /note="SMART: PDZ/DHR/GLGF domain protein; KEGG:
FT                   gwc:GWCH70_2994 PDZ/DHR/GLGF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73224"
FT                   /db_xref="GOA:A0A0F6BIH3"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIH3"
FT                   /inference="protein motif:SMART:SM00228"
FT                   /protein_id="ADP73224.1"
FT                   /translation="MSIWVLEALKGVLRLFAQPLFYFGIVLALAAGWRRVKRERKHFHI
FT                   RVYSPFQESKFFWRSGLAAGLILSLAAVAAGIALPRDAVSLIALVTVAFGLTLQMRLLS
FT                   PAYTVGTALLIISFLASNKEVFPAMKRFFPDLAEANMAALAMLLALLLFVEAWLILRNG
FT                   AIETSPQLAKSKRGLVVGEHWSQRLWLIPVLLPVSGELPPPFSWWPLFPYDEGSYSLML
FT                   VPFLIGFSQRVQGTLPKASIRFAGQKVLLLAWGVSLFAVGGYWYAPLSIVAAALALAGR
FT                   EWLAFYLHRQDRLKPPHFAKREHGLVILGILPHSKAEKMELQIGEVIMKVNGMPVKTEA
FT                   EFYEALQRNRAFCKLEVMDENEEIRFVQGALYEDEHHELGLLFVKERKKWALEAV"
     MSIWVLEALK GVLRLFAQPL FYFGIVLALA AGWRRVKRER KHFHIRVYSP FQESKFFWRS        60
     GLAAGLILSL AAVAAGIALP RDAVSLIALV TVAFGLTLQM RLLSPAYTVG TALLIISFLA       120
     SNKEVFPAMK RFFPDLAEAN MAALAMLLAL LLFVEAWLIL RNGAIETSPQ LAKSKRGLVV       180
     GEHWSQRLWL IPVLLPVSGE LPPPFSWWPL FPYDEGSYSL MLVPFLIGFS QRVQGTLPKA       240
     SIRFAGQKVL LLAWGVSLFA VGGYWYAPLS IVAAALALAG REWLAFYLHR QDRLKPPHFA       300
     KREHGLVILG ILPHSKAEKM ELQIGEVIMK VNGMPVKTEA EFYEALQRNR AFCKLEVMDE       360
     NEEIRFVQGA LYEDEHHELG LLFVKERKKW ALEAV                                  395
//

If you have problems or comments...

PBIL Back to PBIL home page