(data stored in SCRATCH zone)

EMBL: CP002293.PE37

CP002293.PE37        Location/Qualifiers
FT   CDS             49795..50367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0037"
FT                   /product="primase/topoisomerase like protein"
FT                   /note="TIGRFAM: primase/topoisomerase like protein; PFAM:
FT                   TOPRIM domain-containing protein; KEGG: gwc:GWCH70_0036
FT                   primase/topoisomerase like protein; SMART: Toprim sub
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72893"
FT                   /db_xref="GOA:A0A0F6BHJ2"
FT                   /db_xref="InterPro:IPR004466"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR025156"
FT                   /db_xref="InterPro:IPR034141"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHJ2"
FT                   /inference="protein motif:TFAM:TIGR00334"
FT                   /protein_id="ADP72893.1"
FT                   /translation="MMKIKEIIVVEGKDDTVAIQRAVDADTIETNGSAISEEIIEQIKL
FT                   AKEKRGVIIFTDPDFPGEKIRKTITERVPGCKHAFLPRKAAIAKNGKGIGVEHASVEDI
FT                   RQALKNVYEETAEWNEEITFDELVAAGLIGGQLAKKRRQHLGEILKIGYTNGKQLYKRL
FT                   QIFQISKEAFYAALEQVLQEEANDEYK"
     MMKIKEIIVV EGKDDTVAIQ RAVDADTIET NGSAISEEII EQIKLAKEKR GVIIFTDPDF        60
     PGEKIRKTIT ERVPGCKHAF LPRKAAIAKN GKGIGVEHAS VEDIRQALKN VYEETAEWNE       120
     EITFDELVAA GLIGGQLAKK RRQHLGEILK IGYTNGKQLY KRLQIFQISK EAFYAALEQV       180
     LQEEANDEYK                                                              190
//

If you have problems or comments...

PBIL Back to PBIL home page