(data stored in ACNUC7421 zone)

EMBL: CP002293.PE372

CP002293.PE372       Location/Qualifiers
FT   CDS             425814..426140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0386"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gwc:GWCH70_2990 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73228"
FT                   /db_xref="GOA:A0A0F6BIH7"
FT                   /db_xref="InterPro:IPR019109"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIH7"
FT                   /inference="similar to AA sequence:KEGG:GWCH70_2990"
FT                   /protein_id="ADP73228.1"
FT                   /translation="MNSNKVLASLCYFSVLFAGFIFPVIVYFVADDQEVKKHAKKAFLS
FT                   HCIPAATIAIFIILGVTMGAMHQYSDISFFVGGGLVWIGFAIAGIVNLVIVVWNIVQGI
FT                   RVLK"
     MNSNKVLASL CYFSVLFAGF IFPVIVYFVA DDQEVKKHAK KAFLSHCIPA ATIAIFIILG        60
     VTMGAMHQYS DISFFVGGGL VWIGFAIAGI VNLVIVVWNI VQGIRVLK                    108
//

If you have problems or comments...

PBIL Back to PBIL home page