(data stored in ACNUC7421 zone)

EMBL: CP002293.PE373

CP002293.PE373       Location/Qualifiers
FT   CDS             426163..427239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0387"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gwc:GWCH70_2989 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73229"
FT                   /db_xref="InterPro:IPR016599"
FT                   /db_xref="InterPro:IPR025164"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIH8"
FT                   /inference="similar to AA sequence:KEGG:GWCH70_2989"
FT                   /protein_id="ADP73229.1"
FT                   /translation="MEEKKRILKMVQDGKLTVEEALTLLEKLDEQKSATGLLDWHHVSG
FT                   SHANGKQHSVKMDSLKEKLFDFFDATVKKVKEFDFPFANSVEVRHVFQQNDVALQEIDV
FT                   HIANGNIKVVPWEQADVRVECEAKVYRFESPDAARRSFIEETSFFVQNGRFRFSVTKPF
FT                   IKTNATIYVPQAHYQDAHFRLFNGDIEMERLHANKLHVKNVNGSITLQHLFAEEAELET
FT                   ANGSIILERGAVEEVEAETIHGEIKLEGNYRYVRLRTFSGGIAYATEREDGVITGKTVT
FT                   GNIALRLPRNICLEGEIRTNLGGLICQHANVLPVEEKQETAQKLLRFACENPSKPPFHV
FT                   YADSKAGSVSLQMMEEGA"
     MEEKKRILKM VQDGKLTVEE ALTLLEKLDE QKSATGLLDW HHVSGSHANG KQHSVKMDSL        60
     KEKLFDFFDA TVKKVKEFDF PFANSVEVRH VFQQNDVALQ EIDVHIANGN IKVVPWEQAD       120
     VRVECEAKVY RFESPDAARR SFIEETSFFV QNGRFRFSVT KPFIKTNATI YVPQAHYQDA       180
     HFRLFNGDIE MERLHANKLH VKNVNGSITL QHLFAEEAEL ETANGSIILE RGAVEEVEAE       240
     TIHGEIKLEG NYRYVRLRTF SGGIAYATER EDGVITGKTV TGNIALRLPR NICLEGEIRT       300
     NLGGLICQHA NVLPVEEKQE TAQKLLRFAC ENPSKPPFHV YADSKAGSVS LQMMEEGA         358
//

If you have problems or comments...

PBIL Back to PBIL home page