(data stored in ACNUC7421 zone)

EMBL: CP002293.PE375

CP002293.PE375       Location/Qualifiers
FT   CDS             427757..428692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0389"
FT                   /product="HPr kinase"
FT                   /note="KEGG: gwc:GWCH70_2987 HPr kinase; TIGRFAM: HPr(Ser)
FT                   kinase/phosphatase; PFAM: HPr serine kinase
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73231"
FT                   /db_xref="GOA:A0A0F6BII0"
FT                   /db_xref="InterPro:IPR003755"
FT                   /db_xref="InterPro:IPR011104"
FT                   /db_xref="InterPro:IPR011126"
FT                   /db_xref="InterPro:IPR028979"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BII0"
FT                   /inference="protein motif:TFAM:TIGR00679"
FT                   /protein_id="ADP73231.1"
FT                   /translation="MPKVRTKDIIEKFQLELVSGAEGIYRPITTSDLSRPGIEMAGYFA
FT                   YYPAERIQLLGRTELSFYETLSPEEKKIRMERLCTDITPGIIVSRGLEVPPELIEASER
FT                   QSVPVMRSTMKTTRLSSRLTNYLESKLAPTTAVHGVLVDVYGVGVLITGKSGVGKSETA
FT                   LELVKRGHRLVADDCVEIRQEDEGMLVGSAPELIEHLLEIRGLGIINMMTLFGAGAVRT
FT                   HKRISLVIDLELWDPNKQYDRLGLEEEKVKILDTELPKLTIPVRPGRNLAVIVEVAAMN
FT                   FRLKRMGVNAAEEFSARLTDAIEDGEHDYE"
     MPKVRTKDII EKFQLELVSG AEGIYRPITT SDLSRPGIEM AGYFAYYPAE RIQLLGRTEL        60
     SFYETLSPEE KKIRMERLCT DITPGIIVSR GLEVPPELIE ASERQSVPVM RSTMKTTRLS       120
     SRLTNYLESK LAPTTAVHGV LVDVYGVGVL ITGKSGVGKS ETALELVKRG HRLVADDCVE       180
     IRQEDEGMLV GSAPELIEHL LEIRGLGIIN MMTLFGAGAV RTHKRISLVI DLELWDPNKQ       240
     YDRLGLEEEK VKILDTELPK LTIPVRPGRN LAVIVEVAAM NFRLKRMGVN AAEEFSARLT       300
     DAIEDGEHDY E                                                            311
//

If you have problems or comments...

PBIL Back to PBIL home page