(data stored in ACNUC7421 zone)

EMBL: CP002293.PE377

CP002293.PE377       Location/Qualifiers
FT   CDS             429543..430481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0391"
FT                   /product="nucleoside recognition domain protein"
FT                   /note="PFAM: nucleoside recognition domain protein; KEGG:
FT                   gwc:GWCH70_2985 nucleoside recognition domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73233"
FT                   /db_xref="GOA:A0A0F6BII2"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BII2"
FT                   /inference="protein motif:PFAM:PF07670"
FT                   /protein_id="ADP73233.1"
FT                   /translation="MVGILRRGFAVGLQTTWTLGKVIFPITLIVSVLQHTPVLQWIIQL
FT                   VAPLMKWIGLPGDAAIPLVLGNLLNLYAAIGAILTLDLTVKEVLILAVMLSFSHNLLIE
FT                   STVASRTGMSIALMVAVRLSLAIIAALLIHHLWQGGSEAAQYGFVSNSPEQLAGWGAIL
FT                   LAGVKKACLGIVQLAAIVIPLMIGIQILKELEWIHVFSRWMAPLTKMLGMKENTSLTLA
FT                   AGLVFGLAYGAGVMIQAVKEDGVSKRDLTLAFIFLISCHAVIEDTLVFVPLGIPVWPLL
FT                   VIRLATAMLLTMLISFIWNRGKEAKRKEATL"
     MVGILRRGFA VGLQTTWTLG KVIFPITLIV SVLQHTPVLQ WIIQLVAPLM KWIGLPGDAA        60
     IPLVLGNLLN LYAAIGAILT LDLTVKEVLI LAVMLSFSHN LLIESTVASR TGMSIALMVA       120
     VRLSLAIIAA LLIHHLWQGG SEAAQYGFVS NSPEQLAGWG AILLAGVKKA CLGIVQLAAI       180
     VIPLMIGIQI LKELEWIHVF SRWMAPLTKM LGMKENTSLT LAAGLVFGLA YGAGVMIQAV       240
     KEDGVSKRDL TLAFIFLISC HAVIEDTLVF VPLGIPVWPL LVIRLATAML LTMLISFIWN       300
     RGKEAKRKEA TL                                                           312
//

If you have problems or comments...

PBIL Back to PBIL home page