(data stored in ACNUC7421 zone)

EMBL: CP002293.PE38

CP002293.PE38        Location/Qualifiers
FT   CDS             50354..51241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0038"
FT                   /product="dimethyladenosine transferase"
FT                   /note="SMART: Ribosomal RNA adenine methylase
FT                   transferase-like; TIGRFAM: dimethyladenosine transferase;
FT                   KEGG: gwc:GWCH70_0037 dimethyladenosine transferase; PFAM:
FT                   ribosomal RNA adenine methylase transferase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72894"
FT                   /db_xref="GOA:A0A0F6BHJ3"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHJ3"
FT                   /inference="protein motif:TFAM:TIGR00755"
FT                   /protein_id="ADP72894.1"
FT                   /translation="MNTNKDIATPGRTREILEKYGFSFKKSLGQNFLIDTNILRKIVDV
FT                   AGLSRETGAIEIGPGIGALTEQLARRAKKVVAFEIDQRLLPILEDTLSPYENVRIIHQD
FT                   VLKADIHRVIAEEFTDAADIMVVANLPYYVTTPIIMKLLTDNLPIRGIVVMLQKEVADR
FT                   ISAQPGTKDYGSLSIAIQYYTEAEKIMTVPRTVFIPQPNVDSAVIRLIKRKQPPVDVDD
FT                   ESFFFQVVRASFAQRRKTILNNLISNLPNGKARKEKIERILTENGIDPRRRGETLTMEE
FT                   FAALSNALREVMCI"
     MNTNKDIATP GRTREILEKY GFSFKKSLGQ NFLIDTNILR KIVDVAGLSR ETGAIEIGPG        60
     IGALTEQLAR RAKKVVAFEI DQRLLPILED TLSPYENVRI IHQDVLKADI HRVIAEEFTD       120
     AADIMVVANL PYYVTTPIIM KLLTDNLPIR GIVVMLQKEV ADRISAQPGT KDYGSLSIAI       180
     QYYTEAEKIM TVPRTVFIPQ PNVDSAVIRL IKRKQPPVDV DDESFFFQVV RASFAQRRKT       240
     ILNNLISNLP NGKARKEKIE RILTENGIDP RRRGETLTME EFAALSNALR EVMCI            295
//

If you have problems or comments...

PBIL Back to PBIL home page