(data stored in ACNUC7421 zone)

EMBL: CP002293.PE381

CP002293.PE381       Location/Qualifiers
FT   CDS             434064..434684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0396"
FT                   /product="ATP phosphoribosyltransferase"
FT                   /EC_number="2.4.2.17"
FT                   /note="TIGRFAM: ATP phosphoribosyltransferase; KEGG:
FT                   gwc:GWCH70_2980 ATP phosphoribosyltransferase; PFAM: ATP
FT                   phosphoribosyltransferase catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73237"
FT                   /db_xref="GOA:A0A0F6BII6"
FT                   /db_xref="InterPro:IPR001348"
FT                   /db_xref="InterPro:IPR013820"
FT                   /db_xref="InterPro:IPR018198"
FT                   /db_xref="InterPro:IPR024893"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BII6"
FT                   /inference="protein motif:TFAM:TIGR00070"
FT                   /protein_id="ADP73237.1"
FT                   /translation="MLTIAMPKGRIFAEALELLQKAGYTLPAEFAESRKLMMEVPEENM
FT                   RFILAKPMDVVTYVEHGVADLGIAGKDVMMEEERDVYELLDLKISKCHLAVAGLPNGRM
FT                   PQIAPRVATKYPNIASSYFREQGEQVEIIRLNGSIELAPLIGLADRIVDIVSTGRTLKE
FT                   NGLVELEKIADVTSRLIVNPVSYRIKDEEVDVLVCRLSEVIPQ"
     MLTIAMPKGR IFAEALELLQ KAGYTLPAEF AESRKLMMEV PEENMRFILA KPMDVVTYVE        60
     HGVADLGIAG KDVMMEEERD VYELLDLKIS KCHLAVAGLP NGRMPQIAPR VATKYPNIAS       120
     SYFREQGEQV EIIRLNGSIE LAPLIGLADR IVDIVSTGRT LKENGLVELE KIADVTSRLI       180
     VNPVSYRIKD EEVDVLVCRL SEVIPQ                                            206
//

If you have problems or comments...

PBIL Back to PBIL home page