(data stored in ACNUC7421 zone)

EMBL: CP002293.PE382

CP002293.PE382       Location/Qualifiers
FT   CDS             434700..435968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0397"
FT                   /product="histidinol dehydrogenase"
FT                   /EC_number="1.1.1.23"
FT                   /note="TIGRFAM: histidinol dehydrogenase; KEGG:
FT                   gwc:GWCH70_2979 histidinol dehydrogenase; PFAM: Histidinol
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73238"
FT                   /db_xref="GOA:A0A0F6BII7"
FT                   /db_xref="InterPro:IPR001692"
FT                   /db_xref="InterPro:IPR012131"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR022695"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BII7"
FT                   /inference="protein motif:TFAM:TIGR00069"
FT                   /protein_id="ADP73238.1"
FT                   /translation="MKIERVKSRVSLRRTIESGTEEQRRAVLEIISTVRARGDEALKSY
FT                   TEKFDGVRLDSLRVTNEEIEAAYQNVSEEALRIIREAAENIRDYHERQKRESWIIAKED
FT                   GTMLGQKITPLDAVGLYVPGGTAAYPSSVLMNVIPAQVAGVKRIVITSPPNKNGTLPAG
FT                   VLVAASELGVKEIYKVGGAQAIAALAYGTETIRPVDKIFGPGNIYVALAKREVFGQVAI
FT                   DMIAGPSEIVVLADETANVNEIAADLLSQAEHDERASAILVTPSMKLALAVASEVKKQL
FT                   ETLPRKAIAVSALENYGAIYVTETLAEAVEVVNELAPEHLEVMTAEPMQLLGQIRHAGA
FT                   IFLGRFSSEPVGDYFAGPNHVLPTNGTARFSSGLSVDEFVKKSSIIFYSEPALQRNAGK
FT                   IAAFARLEGLEAHARAVEERFKK"
     MKIERVKSRV SLRRTIESGT EEQRRAVLEI ISTVRARGDE ALKSYTEKFD GVRLDSLRVT        60
     NEEIEAAYQN VSEEALRIIR EAAENIRDYH ERQKRESWII AKEDGTMLGQ KITPLDAVGL       120
     YVPGGTAAYP SSVLMNVIPA QVAGVKRIVI TSPPNKNGTL PAGVLVAASE LGVKEIYKVG       180
     GAQAIAALAY GTETIRPVDK IFGPGNIYVA LAKREVFGQV AIDMIAGPSE IVVLADETAN       240
     VNEIAADLLS QAEHDERASA ILVTPSMKLA LAVASEVKKQ LETLPRKAIA VSALENYGAI       300
     YVTETLAEAV EVVNELAPEH LEVMTAEPMQ LLGQIRHAGA IFLGRFSSEP VGDYFAGPNH       360
     VLPTNGTARF SSGLSVDEFV KKSSIIFYSE PALQRNAGKI AAFARLEGLE AHARAVEERF       420
     KK                                                                      422
//

If you have problems or comments...

PBIL Back to PBIL home page