(data stored in ACNUC7421 zone)

EMBL: CP002293.PE384

CP002293.PE384       Location/Qualifiers
FT   CDS             436572..437207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0399"
FT                   /product="imidazole glycerol phosphate synthase, glutamine
FT                   amidotransferase subunit"
FT                   /note="KEGG: gwc:GWCH70_2977 imidazole glycerol phosphate
FT                   synthase, glutamine amidotransferase subunit; TIGRFAM:
FT                   imidazole glycerol phosphate synthase, glutamine
FT                   amidotransferase subunit; PFAM: glutamine amidotransferase
FT                   class-I"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73240"
FT                   /db_xref="GOA:A0A0F6BII9"
FT                   /db_xref="InterPro:IPR010139"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BII9"
FT                   /inference="protein motif:TFAM:TIGR01855"
FT                   /protein_id="ADP73240.1"
FT                   /translation="MIGIIDYGMGNLYSVSKALERLRYEYVVSDQPNVLKQTKGLILPG
FT                   VGSFKDAMHILRKTKLDKFIREAVNEGTPLFGICLGMQLLFEESEENGLTEGLGLLSGR
FT                   VVRIPGVTAGGERYKVPHMGWNRLVFRHPSPLLQNVEEGHVYFVHSYYVVTDDDSVVLA
FT                   SSFYDVEVPAVVGKGNVYGTQFHPEKSGEVGMKILQNYAAIVEGKGRV"
     MIGIIDYGMG NLYSVSKALE RLRYEYVVSD QPNVLKQTKG LILPGVGSFK DAMHILRKTK        60
     LDKFIREAVN EGTPLFGICL GMQLLFEESE ENGLTEGLGL LSGRVVRIPG VTAGGERYKV       120
     PHMGWNRLVF RHPSPLLQNV EEGHVYFVHS YYVVTDDDSV VLASSFYDVE VPAVVGKGNV       180
     YGTQFHPEKS GEVGMKILQN YAAIVEGKGR V                                      211
//

If you have problems or comments...

PBIL Back to PBIL home page