(data stored in SCRATCH zone)

EMBL: CP002293.PE385

CP002293.PE385       Location/Qualifiers
FT   CDS             437207..437944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0400"
FT                   /product="phosphoribosylformimino-5-aminoimidazole
FT                   carboxamide ribotide isomerase"
FT                   /EC_number="5.3.1.16"
FT                   /note="TIGRFAM: phosphoribosylformimino-5-aminoimidazole
FT                   carboxamide ribotide isomerase; KEGG: gwc:GWCH70_2976
FT                   phosphoribosylformimino-5-aminoimidazole carboxamide
FT                   ribotide isomerase; PFAM: histidine biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73241"
FT                   /db_xref="GOA:A0A0F6BIJ0"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR006063"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023016"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIJ0"
FT                   /inference="protein motif:TFAM:TIGR00007"
FT                   /protein_id="ADP73241.1"
FT                   /translation="MAAFTIYPAIDIRGGKCVRLLQGDYTKETVYGDSPVEMAALFAEQ
FT                   GAEWIHMVDLDGAKEGKRVNDRFVVEAAKQLPVKVQIGGGIRTEDDIVYYLENGVARVI
FT                   LGSAAIARPSFVKEMLKKYGERIAIGIDAKDGFVATEGWLHTSNVKATDLGKELAEAGA
FT                   QTFIFTDIATDGMLSGPNIQAAVEMARATGKDVIASGGVRSLADLVSLQNHVGDGVAGA
FT                   IVGKALYTKQFTVAEALKVVQGE"
     MAAFTIYPAI DIRGGKCVRL LQGDYTKETV YGDSPVEMAA LFAEQGAEWI HMVDLDGAKE        60
     GKRVNDRFVV EAAKQLPVKV QIGGGIRTED DIVYYLENGV ARVILGSAAI ARPSFVKEML       120
     KKYGERIAIG IDAKDGFVAT EGWLHTSNVK ATDLGKELAE AGAQTFIFTD IATDGMLSGP       180
     NIQAAVEMAR ATGKDVIASG GVRSLADLVS LQNHVGDGVA GAIVGKALYT KQFTVAEALK       240
     VVQGE                                                                   245
//

If you have problems or comments...

PBIL Back to PBIL home page