(data stored in ACNUC7421 zone)

EMBL: CP002293.PE387

CP002293.PE387       Location/Qualifiers
FT   CDS             438696..439328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0402"
FT                   /product="phosphoribosyl-ATP diphosphatase"
FT                   /note="KEGG: gwc:GWCH70_2974 phosphoribosyl-ATP
FT                   diphosphatase; TIGRFAM: phosphoribosyl-ATP diphosphatase;
FT                   PFAM: phosphoribosyl-AMP cyclohydrolase; Phosphoribosyl-ATP
FT                   pyrophosphohydrolase-like"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73243"
FT                   /db_xref="GOA:A0A0F6BIJ2"
FT                   /db_xref="InterPro:IPR002496"
FT                   /db_xref="InterPro:IPR008179"
FT                   /db_xref="InterPro:IPR021130"
FT                   /db_xref="InterPro:IPR023019"
FT                   /db_xref="InterPro:IPR026660"
FT                   /db_xref="InterPro:IPR038019"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIJ2"
FT                   /inference="protein motif:TFAM:TIGR03188"
FT                   /protein_id="ADP73243.1"
FT                   /translation="MNLANIRFDEKGLVPAIVQDAQSKEVLMLAYMNEESLKKSLETGE
FT                   TWFYSRSRKELWHKGATSGNIQRIVDMRYDCDSDSLLVLVEPAGPACHTGSYSCFFNRM
FT                   NGEKCETSPNRFAILNTLEEIIAKRDAERPEGAYTTYLFEKGVDKILKKVGEEAAEVII
FT                   AAKNRNHDELKWEVADLLYHLLVLLREQKLPLDAVLEVLAERHNAKQ"
     MNLANIRFDE KGLVPAIVQD AQSKEVLMLA YMNEESLKKS LETGETWFYS RSRKELWHKG        60
     ATSGNIQRIV DMRYDCDSDS LLVLVEPAGP ACHTGSYSCF FNRMNGEKCE TSPNRFAILN       120
     TLEEIIAKRD AERPEGAYTT YLFEKGVDKI LKKVGEEAAE VIIAAKNRNH DELKWEVADL       180
     LYHLLVLLRE QKLPLDAVLE VLAERHNAKQ                                        210
//

If you have problems or comments...

PBIL Back to PBIL home page