(data stored in ACNUC7421 zone)

EMBL: CP002293.PE388

CP002293.PE388       Location/Qualifiers
FT   CDS             439439..440917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0403"
FT                   /product="Tetratricopeptide repeat protein"
FT                   /note="SMART: Tetratricopeptide repeat; KEGG:
FT                   gwc:GWCH70_2973 tetratricopeptide TPR_2 repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73244"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIJ3"
FT                   /inference="protein motif:SMART:SM00028"
FT                   /protein_id="ADP73244.1"
FT                   /translation="MGKQLKPKQRGTKIIPFIQNGEYYFKKGMQAYQQRDLYKAKKYLE
FT                   RAVQYDGNNASFALQLASVLAELGEYQASNQWLFKIIHELDETMDECFYFLANNFAHLG
FT                   LFHEAMKYAETYLARDPDGHFAEDTEDLMELLKIDQEDENGDEQDDLITQQERARLLLE
FT                   KEKFPEAIRLLEMIIDRYPEFWSAYNNLALAYFYNGNVQKAQEIIEQVLERNPGNLHAL
FT                   CNRLVFYYYLRDERQVNRLSDQLACVHPFFIEHRYKLGATFALVGRFDLAFKWLYHLYK
FT                   IRYDGDDAFYYWLAYAAYYTGREELAKNVWEKVIEANPNKRGEEPWAFSVPSVDPELQK
FT                   IIRWFDRMNIAEMLYGLYLLSESPYKNDPAVSVAIRRYLVDHPLLSQFADYFLFREAEV
FT                   SPPYVVDSHIIINKLSEKNERADETMYIAWFSVVVNASAKERFSNHSAWSAALEYVWRQ
FT                   RQGQHVTQKWIADKYHVSLSTVKKYVKKVKELLS"
     MGKQLKPKQR GTKIIPFIQN GEYYFKKGMQ AYQQRDLYKA KKYLERAVQY DGNNASFALQ        60
     LASVLAELGE YQASNQWLFK IIHELDETMD ECFYFLANNF AHLGLFHEAM KYAETYLARD       120
     PDGHFAEDTE DLMELLKIDQ EDENGDEQDD LITQQERARL LLEKEKFPEA IRLLEMIIDR       180
     YPEFWSAYNN LALAYFYNGN VQKAQEIIEQ VLERNPGNLH ALCNRLVFYY YLRDERQVNR       240
     LSDQLACVHP FFIEHRYKLG ATFALVGRFD LAFKWLYHLY KIRYDGDDAF YYWLAYAAYY       300
     TGREELAKNV WEKVIEANPN KRGEEPWAFS VPSVDPELQK IIRWFDRMNI AEMLYGLYLL       360
     SESPYKNDPA VSVAIRRYLV DHPLLSQFAD YFLFREAEVS PPYVVDSHII INKLSEKNER       420
     ADETMYIAWF SVVVNASAKE RFSNHSAWSA ALEYVWRQRQ GQHVTQKWIA DKYHVSLSTV       480
     KKYVKKVKEL LS                                                           492
//

If you have problems or comments...

PBIL Back to PBIL home page