(data stored in ACNUC7421 zone)

EMBL: CP002293.PE392

CP002293.PE392       Location/Qualifiers
FT   CDS             443570..444553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0407"
FT                   /product="protein of unknown function UPF0052 and CofD"
FT                   /note="PFAM: protein of unknown function UPF0052 and CofD;
FT                   KEGG: gwc:GWCH70_2969 protein of unknown function UPF0052
FT                   and CofD"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73248"
FT                   /db_xref="GOA:A0A0F6BIJ7"
FT                   /db_xref="InterPro:IPR002882"
FT                   /db_xref="InterPro:IPR010119"
FT                   /db_xref="InterPro:IPR038136"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIJ7"
FT                   /inference="protein motif:PFAM:PF01933"
FT                   /protein_id="ADP73248.1"
FT                   /translation="MNAKSQPKIVIIGGGTGLPVLLRGLKQYAVDITAIVTVADDGGSS
FT                   GRLRDELQIPPPGDVRNVLAALSDVEPLVIELFQHRFQNGNGLSGHSLGNLILAALTSI
FT                   TGDFVKAIREMSKVLKVHGQVLPAANKSVVLHAEMEDGAIVSGESKIPYSGKRIKKVFL
FT                   TPENVEPLPETIDAIRSADLIVIGPGSLYTSILPNLLVPKIGQEVCRAKAKKVYICNVM
FT                   TQAGETLHYTVSDHVKALHDHMGCLFLDVVVVNNGHIPEEIQRRYAEELAEPVKDDGDR
FT                   LAELGIEVIRDNIVSYEDRVIRHDTKKVASLLISLITAPPSSQWHE"
     MNAKSQPKIV IIGGGTGLPV LLRGLKQYAV DITAIVTVAD DGGSSGRLRD ELQIPPPGDV        60
     RNVLAALSDV EPLVIELFQH RFQNGNGLSG HSLGNLILAA LTSITGDFVK AIREMSKVLK       120
     VHGQVLPAAN KSVVLHAEME DGAIVSGESK IPYSGKRIKK VFLTPENVEP LPETIDAIRS       180
     ADLIVIGPGS LYTSILPNLL VPKIGQEVCR AKAKKVYICN VMTQAGETLH YTVSDHVKAL       240
     HDHMGCLFLD VVVVNNGHIP EEIQRRYAEE LAEPVKDDGD RLAELGIEVI RDNIVSYEDR       300
     VIRHDTKKVA SLLISLITAP PSSQWHE                                           327
//

If you have problems or comments...

PBIL Back to PBIL home page