(data stored in ACNUC7421 zone)

EMBL: CP002293.PE393

CP002293.PE393       Location/Qualifiers
FT   CDS             444574..445536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0408"
FT                   /product="protein of unknown function DUF199"
FT                   /note="PFAM: protein of unknown function DUF199;
FT                   Sporulation regulator WhiA-like; KEGG: gwc:GWCH70_2968
FT                   protein of unknown function DUF199"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73249"
FT                   /db_xref="GOA:A0A0F6BIJ8"
FT                   /db_xref="InterPro:IPR003802"
FT                   /db_xref="InterPro:IPR018478"
FT                   /db_xref="InterPro:IPR023054"
FT                   /db_xref="InterPro:IPR027434"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039518"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIJ8"
FT                   /inference="protein motif:PFAM:PF02650"
FT                   /protein_id="ADP73249.1"
FT                   /translation="MSFASETKKELTNLEVKPCCLKAELSALLRMNGLLSFSNRKIIVD
FT                   VQTENAAIARRIYTLLKKGYEVTVELLVRKKMRLKKNNVYIVRIVDGAHELLKDLKILE
FT                   EDFSLIRVISPELVKKKCCKRSYLRGAFLAGGSVNNPETSSYHLEIFSLYEEHNDSLCE
FT                   LMNSHFFLNAKTLERKKGFITYLKEAEKISEFLNIIGAHQALLRFEDIRIVRDMRNSVN
FT                   RLVNCETANLNKTIGAALRQVENIRYIDETIGLSSLPDKLREIAELRMMYQDVTLKELG
FT                   ELVSGGKISKSGINHRLRKIDEIAERLRAGKPVDFHKSL"
     MSFASETKKE LTNLEVKPCC LKAELSALLR MNGLLSFSNR KIIVDVQTEN AAIARRIYTL        60
     LKKGYEVTVE LLVRKKMRLK KNNVYIVRIV DGAHELLKDL KILEEDFSLI RVISPELVKK       120
     KCCKRSYLRG AFLAGGSVNN PETSSYHLEI FSLYEEHNDS LCELMNSHFF LNAKTLERKK       180
     GFITYLKEAE KISEFLNIIG AHQALLRFED IRIVRDMRNS VNRLVNCETA NLNKTIGAAL       240
     RQVENIRYID ETIGLSSLPD KLREIAELRM MYQDVTLKEL GELVSGGKIS KSGINHRLRK       300
     IDEIAERLRA GKPVDFHKSL                                                   320
//

If you have problems or comments...

PBIL Back to PBIL home page