(data stored in ACNUC7421 zone)

EMBL: CP002293.PE395

CP002293.PE395       Location/Qualifiers
FT   CDS             complement(445863..446453)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0410"
FT                   /product="ATP-dependent Clp protease, proteolytic subunit
FT                   ClpP"
FT                   /EC_number="3.4.21.92"
FT                   /note="TIGRFAM: ATP-dependent Clp protease, proteolytic
FT                   subunit ClpP; KEGG: gwc:GWCH70_2966 ATP-dependent Clp
FT                   protease, proteolytic subunit ClpP; PFAM: peptidase S14
FT                   ClpP"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73251"
FT                   /db_xref="GOA:A0A0F6BIK0"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR018215"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR033135"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIK0"
FT                   /inference="protein motif:TFAM:TIGR00493"
FT                   /protein_id="ADP73251.1"
FT                   /translation="MNLIPTVIEQTSRGERAYDIYSRLLKDRIIILGSPIDDQVANSIV
FT                   SQLLFLAAEDPEKDISLYINSPGGSITAGLAIYDTMQFIKPDVSTICIGMAASMGAFLL
FT                   AAGAKGKRFALPNSEIMIHQPLGGAQGQATEIEIAAKRILFLRDKLNRILSENTGQPID
FT                   VIERDTDRDNFMTAQKAQEYGIIDRVLTRVDEK"
     MNLIPTVIEQ TSRGERAYDI YSRLLKDRII ILGSPIDDQV ANSIVSQLLF LAAEDPEKDI        60
     SLYINSPGGS ITAGLAIYDT MQFIKPDVST ICIGMAASMG AFLLAAGAKG KRFALPNSEI       120
     MIHQPLGGAQ GQATEIEIAA KRILFLRDKL NRILSENTGQ PIDVIERDTD RDNFMTAQKA       180
     QEYGIIDRVL TRVDEK                                                       196
//

If you have problems or comments...

PBIL Back to PBIL home page