(data stored in ACNUC7421 zone)

EMBL: CP002293.PE396

CP002293.PE396       Location/Qualifiers
FT   CDS             447119..448432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0411"
FT                   /product="RNA polymerase, sigma 54 subunit, RpoN"
FT                   /note="KEGG: gwc:GWCH70_2965 RNA polymerase, sigma 54
FT                   subunit, RpoN; TIGRFAM: RNA polymerase sigma-54 factor,
FT                   RpoN; PFAM: sigma-54 DNA-binding domain protein; sigma-54
FT                   factor core-binding region; sigma-54 factor"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73252"
FT                   /db_xref="GOA:A0A0F6BIK1"
FT                   /db_xref="InterPro:IPR000394"
FT                   /db_xref="InterPro:IPR007046"
FT                   /db_xref="InterPro:IPR007634"
FT                   /db_xref="InterPro:IPR038709"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIK1"
FT                   /inference="protein motif:TFAM:TIGR02395"
FT                   /protein_id="ADP73252.1"
FT                   /translation="MRAELWQEQRLKLSLTKELTQAIELLQYSAVELQSFLYEQSLDNP
FT                   FLEIRDYRLKRSYRDSSDKEKQRWIENISTHSETLSLHLIAQLPALSLSEREERVVRYM
FT                   IASLDEDGYLRVEIEEIAARLAISKQEAEKALQIIQSLEPAGVGARSLQECLYLQLKRL
FT                   PHRDELAEQIVQHHFSLFVEKAWKTLAKQLDIDIASLQRVWDLIRTLEPRPGIHYTKEM
FT                   PHFIVPDLIIERSDEGDWRIFCNDDVHPELAWNRAYEQKISGYRDGQVQSFIKDKYRQF
FT                   LWLTKSLEQRKQTLLNIMHVIVDKQKQCLEAGFAALKPLTMREVAEELGIHESTVSRAV
FT                   KNKYVQTPFGTVELRRFFSNAVSSAYADDDAASSVKVKMFIKQLIEQENKQRPLSDQKI
FT                   ADLLHERYGVAVSRRTVAKYREQLHIPSSAKRKQYVGK"
     MRAELWQEQR LKLSLTKELT QAIELLQYSA VELQSFLYEQ SLDNPFLEIR DYRLKRSYRD        60
     SSDKEKQRWI ENISTHSETL SLHLIAQLPA LSLSEREERV VRYMIASLDE DGYLRVEIEE       120
     IAARLAISKQ EAEKALQIIQ SLEPAGVGAR SLQECLYLQL KRLPHRDELA EQIVQHHFSL       180
     FVEKAWKTLA KQLDIDIASL QRVWDLIRTL EPRPGIHYTK EMPHFIVPDL IIERSDEGDW       240
     RIFCNDDVHP ELAWNRAYEQ KISGYRDGQV QSFIKDKYRQ FLWLTKSLEQ RKQTLLNIMH       300
     VIVDKQKQCL EAGFAALKPL TMREVAEELG IHESTVSRAV KNKYVQTPFG TVELRRFFSN       360
     AVSSAYADDD AASSVKVKMF IKQLIEQENK QRPLSDQKIA DLLHERYGVA VSRRTVAKYR       420
     EQLHIPSSAK RKQYVGK                                                      437
//

If you have problems or comments...

PBIL Back to PBIL home page