(data stored in ACNUC7421 zone)

EMBL: CP002293.PE397

CP002293.PE397       Location/Qualifiers
FT   CDS             448439..448684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0412"
FT                   /product="glutaredoxin 2"
FT                   /note="PFAM: glutaredoxin 2; KEGG: gwc:GWCH70_2964
FT                   glutaredoxin 2"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73253"
FT                   /db_xref="GOA:A0A0F6BIK2"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR008554"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIK2"
FT                   /inference="protein motif:PFAM:PF05768"
FT                   /protein_id="ADP73253.1"
FT                   /translation="MIIRLYSKTNCPLCDKAKQVLQELQKEFAFQIKEIDIYQDDALLE
FT                   KYQLMIPVVEIDGEEVGFGIIQKDVIRKRLLEARNS"
     MIIRLYSKTN CPLCDKAKQV LQELQKEFAF QIKEIDIYQD DALLEKYQLM IPVVEIDGEE        60
     VGFGIIQKDV IRKRLLEARN S                                                  81
//

If you have problems or comments...

PBIL Back to PBIL home page