(data stored in ACNUC7421 zone)

EMBL: CP002293.PE398

CP002293.PE398       Location/Qualifiers
FT   CDS             448813..449832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0413"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /note="PFAM: sugar-binding domain-containing protein; KEGG:
FT                   gwc:GWCH70_2963 transcriptional regulator, DeoR family"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73254"
FT                   /db_xref="GOA:A0A0F6BIK3"
FT                   /db_xref="InterPro:IPR007324"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIK3"
FT                   /inference="protein motif:PFAM:PF04198"
FT                   /protein_id="ADP73254.1"
FT                   /translation="MQSLIEAQKKLLPDLLEIMQKRYRILRYISLMQPVGRRVLSNSLG
FT                   ISERVLRSEVQFLKEQNLLTISSAGMSLTQEGKGLLHTLEDVMREVLGLKDLETKLKRK
FT                   LHVEKIIVVAGDSDLSPWVKKEMGKACVTCMKERLANGDIVAVTGGTTMAAVAEMMTPD
FT                   AKLNDLLFVPARGGLGENVENQANTICAKMAEKSSGNYRLLHVPDHLSREAYESLIEEP
FT                   TVKEVLELIKSCRMVVHGIGDAITMAERRKTPNEDMAKIQARHAVAEAFGYYFNEKGEV
FT                   VHKVKTVGIQLEDLPRVEHVIAVAGGSSKAKAIQAYMKRAHHSILITDEGAAKALLGE"
     MQSLIEAQKK LLPDLLEIMQ KRYRILRYIS LMQPVGRRVL SNSLGISERV LRSEVQFLKE        60
     QNLLTISSAG MSLTQEGKGL LHTLEDVMRE VLGLKDLETK LKRKLHVEKI IVVAGDSDLS       120
     PWVKKEMGKA CVTCMKERLA NGDIVAVTGG TTMAAVAEMM TPDAKLNDLL FVPARGGLGE       180
     NVENQANTIC AKMAEKSSGN YRLLHVPDHL SREAYESLIE EPTVKEVLEL IKSCRMVVHG       240
     IGDAITMAER RKTPNEDMAK IQARHAVAEA FGYYFNEKGE VVHKVKTVGI QLEDLPRVEH       300
     VIAVAGGSSK AKAIQAYMKR AHHSILITDE GAAKALLGE                              339
//

If you have problems or comments...

PBIL Back to PBIL home page