(data stored in ACNUC7421 zone)

EMBL: CP002293.PE40

CP002293.PE40        Location/Qualifiers
FT   CDS             52425..52682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0040"
FT                   /product="protein of unknown function DUF1021"
FT                   /note="PFAM: protein of unknown function DUF1021; KEGG:
FT                   gtn:GTNG_0037 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72896"
FT                   /db_xref="GOA:A0A0F6BHJ5"
FT                   /db_xref="InterPro:IPR009366"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHJ5"
FT                   /inference="protein motif:PFAM:PF06257"
FT                   /protein_id="ADP72896.1"
FT                   /translation="MPKTLSDIKKTLDSNIGRRLTLRANGGRRKTIERCGILAETYPSV
FT                   FVIELDQKENAFERVSFSYADVLTETVKLTFLDDEKVGGQ"
     MPKTLSDIKK TLDSNIGRRL TLRANGGRRK TIERCGILAE TYPSVFVIEL DQKENAFERV        60
     SFSYADVLTE TVKLTFLDDE KVGGQ                                              85
//

If you have problems or comments...

PBIL Back to PBIL home page