(data stored in ACNUC7421 zone)

EMBL: CP002293.PE401

CP002293.PE401       Location/Qualifiers
FT   CDS             452233..452994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0416"
FT                   /product="triosephosphate isomerase"
FT                   /EC_number="5.3.1.1"
FT                   /note="PFAM: triosephosphate isomerase; manually curated;
FT                   KEGG: gwc:GWCH70_2960 triosephosphate isomerase; TIGRFAM:
FT                   triosephosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73257"
FT                   /db_xref="GOA:A0A0F6BIK6"
FT                   /db_xref="InterPro:IPR000652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020861"
FT                   /db_xref="InterPro:IPR022896"
FT                   /db_xref="InterPro:IPR035990"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIK6"
FT                   /inference="protein motif:TFAM:TIGR00419"
FT                   /protein_id="ADP73257.1"
FT                   /translation="MRKRIIAGNWKMHKTLPEAVSFVEEVKRLVPPAEQVDSVICAPFL
FT                   FLDRLVQNVQGSDLKIGAQNMHFEDKGAFTGEISPVALKDIGVAYVIIGHSERREMFAE
FT                   TDETVNKKVHAAFKHGLIPIVCCGETLEQRESGKTNDIVGAQVEKALAGLTAEQAKQVV
FT                   IAYEPIWAIGTGKSSTAEDANEVCGHIRSVIAKIFSPEVAEAVRIQYGGSVKPENIREF
FT                   LAQEHIDGALVGGASLDPKSFLQLVEAGQHE"
     MRKRIIAGNW KMHKTLPEAV SFVEEVKRLV PPAEQVDSVI CAPFLFLDRL VQNVQGSDLK        60
     IGAQNMHFED KGAFTGEISP VALKDIGVAY VIIGHSERRE MFAETDETVN KKVHAAFKHG       120
     LIPIVCCGET LEQRESGKTN DIVGAQVEKA LAGLTAEQAK QVVIAYEPIW AIGTGKSSTA       180
     EDANEVCGHI RSVIAKIFSP EVAEAVRIQY GGSVKPENIR EFLAQEHIDG ALVGGASLDP       240
     KSFLQLVEAG QHE                                                          253
//

If you have problems or comments...

PBIL Back to PBIL home page