(data stored in ACNUC7421 zone)

EMBL: CP002293.PE403

CP002293.PE403       Location/Qualifiers
FT   CDS             454544..455836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0418"
FT                   /product="enolase"
FT                   /EC_number="4.2.1.11"
FT                   /note="TIGRFAM: enolase; KEGG: gwc:GWCH70_2958 enolase;
FT                   PFAM: Enolase-like"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73259"
FT                   /db_xref="GOA:A0A0F6BIK8"
FT                   /db_xref="InterPro:IPR000941"
FT                   /db_xref="InterPro:IPR020809"
FT                   /db_xref="InterPro:IPR020810"
FT                   /db_xref="InterPro:IPR020811"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIK8"
FT                   /inference="protein motif:TFAM:TIGR01060"
FT                   /protein_id="ADP73259.1"
FT                   /translation="MSAILDVYAREVLDSRGNPTVEVEIYTEDGGFGRALVPSGASTGE
FT                   YEAVELRDGDKSRYLGKGVLKAVENVNEVIAPAIIGLEVTDQVGIDKTLIELDGTENKS
FT                   KLGANAILGVSLAVARAAADELGMPLYQYLGGFNAKTLPVPMMNILNGGAHADNNVDIQ
FT                   EFMIMPVGAKSFREALRMGAEIFHSLKAVLKAKGYNTAVGDEGGFAPNLKSNEEALQTI
FT                   IEAIEKAGYKPGEEVMLAMDVASSELYNKEDGKYHLEGEGVVRTSEEMVAWYEELVSKY
FT                   PIISIEDGLDENDWEGHKLLTERLGKKVQLVGDDLFVTNTKKLAEGIEKGVGNSILIKV
FT                   NQIGTLTETFDAIEMAKRAGYTAVVSHRSGETEDSTIADIAVATNAGQIKTGAPSRTDR
FT                   VAKYNQLLRIEDQLGDTAIYNGIKSFYNLKK"
     MSAILDVYAR EVLDSRGNPT VEVEIYTEDG GFGRALVPSG ASTGEYEAVE LRDGDKSRYL        60
     GKGVLKAVEN VNEVIAPAII GLEVTDQVGI DKTLIELDGT ENKSKLGANA ILGVSLAVAR       120
     AAADELGMPL YQYLGGFNAK TLPVPMMNIL NGGAHADNNV DIQEFMIMPV GAKSFREALR       180
     MGAEIFHSLK AVLKAKGYNT AVGDEGGFAP NLKSNEEALQ TIIEAIEKAG YKPGEEVMLA       240
     MDVASSELYN KEDGKYHLEG EGVVRTSEEM VAWYEELVSK YPIISIEDGL DENDWEGHKL       300
     LTERLGKKVQ LVGDDLFVTN TKKLAEGIEK GVGNSILIKV NQIGTLTETF DAIEMAKRAG       360
     YTAVVSHRSG ETEDSTIADI AVATNAGQIK TGAPSRTDRV AKYNQLLRIE DQLGDTAIYN       420
     GIKSFYNLKK                                                              430
//

If you have problems or comments...

PBIL Back to PBIL home page